Protein Family IF06976

Metagenome Isolate
177 Members
62 Samples
152 Scaffolds
123.8 Avg Length

🧬 Representative Sequence

ID
3300042611|Ga0466697_029705|Ga0466697_029705_573_980
Length
135 aa
Sequence
MNIEELREYCISVKGASECFPFDENVLVFKIMDKMFVYVDLSPKDGKFKVNMKCDPEKSVELREKYQGVRQGIHTRSIMWNAVCLANDVPDKLIKELIEHSVEEVIKNLPRKKQEEYRKIVVNARTSCEAQVVSD

📊 Sample Types

Isolate 14.1%
Metagenome 85.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 49.2%
Blattidae 24.6%
Unclassified 16.4%
Kalotermitidae 6.6%
Rhinotermitidae 1.6%
Passalidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
2 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
3 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
4 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
12 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
13 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
14 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
15 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
16 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
17 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
18 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
19 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 3004667792 Bacteroides sp. 519 Isolate Blattidae
22 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
23 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
24 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
25 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
26 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
27 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
36 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
37 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
40 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
41 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
42 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
45 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
46 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
47 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
48 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
49 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
50 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
51 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
52 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
53 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
54 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
55 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
58 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
59 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
60 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
61 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
62 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_181384 3300042659 Bacteria 1259
2 Ga0123356_10172941 3300010049 Bacteria 2173
3 Ga0123356_10496518 3300010049 Unclassified 1376
4 Ga0123356_10828644 3300010049 Bacteria 1096
5 Ga0123356_11003604 3300010049 Bacteria 1005
6 Ga0123356_11145768 3300010049 Bacteria 945
7 Ga0123353_10402243 3300010167 Bacteria 2037
8 Ga0466656_155681 3300042550 Bacteria 12058
9 Ga0466656_385504 3300042550 Bacteria 1043
10 Ga0466657_276582 3300042582 Bacteria 1983
11 Ga0466693_116773 3300042592 Bacteria 1642
12 Ga0466695_101683 3300042595 Unclassified 2158
13 Ga0466695_161380 3300042595 Bacteria 1286
14 Ga0466700_194419 3300042600 Bacteria 2895
15 Ga0466700_369835 3300042600 Bacteria 46737
16 Ga0466719_267332 3300042606 Unclassified 2442
17 Ga0466721_177708 3300042608 Bacteria 28405
18 Ga0466725_030949 3300042654 Bacteria 1043
19 JGI24702J35022_10025306 3300002462 Bacteria 3203
20 JGI24702J35022_10027236 3300002462 Bacteria 3075
21 JGI24702J35022_10422881 3300002462 Bacteria 808
22 Ga0466710_336335 3300042613 Bacteria 10060
23 Ga0466718_088057 3300042617 Bacteria 1154
24 Ga0466732_013941 3300042656 Unclassified 1632
25 Ga0123356_10042144 3300010049 Bacteria 4253
26 Ga0123356_10317757 3300010049 Bacteria 1669
27 Ga0123356_12491983 3300010049 Bacteria 647
28 Ga0123353_10080166 3300010167 Bacteria 5250
29 Ga0123353_10899644 3300010167 Bacteria 1205
30 Ga0123353_11116639 3300010167 Bacteria 1045
31 Ga0123353_11134201 3300010167 Bacteria 1034
32 Ga0123353_11969067 3300010167 Unclassified 717
33 Ga0466657_301850 3300042582 Bacteria 8674
34 Ga0466700_247662 3300042600 Bacteria 1732
35 Ga0466700_399343 3300042600 Bacteria 1050
36 Ga0466714_106307 3300042603 Bacteria 1418
37 Ga0466719_040438 3300042606 Bacteria 1108
38 Ga0466721_356709 3300042608 Bacteria 1625
39 Ga0466734_132938 3300042623 Bacteria 1095
40 Ga0466724_07801 3300042649 Bacteria 9049
41 Ga0466725_466266 3300042654 Bacteria 1683
42 IMNBL1DRAFT_c0031192 3300000062 Bacteria 1942
43 JGI24702J35022_10015184 3300002462 Bacteria 4241
44 JGI24702J35022_10015997 3300002462 Bacteria 4119
45 Ga0466697_243848 3300042611 Unclassified 2513
46 Ga0123356_11958637 3300010049 Bacteria 730
47 Ga0123356_13111873 3300010049 Bacteria 578
48 Ga0123353_10685180 3300010167 Bacteria 1442
49 Ga0123353_11004166 3300010167 Bacteria 1121
50 Ga0466657_192876 3300042582 Bacteria 2270
51 Ga0466693_420270 3300042592 Bacteria 2236
52 Ga0466695_214989 3300042595 Bacteria 12980
53 Ga0466719_402403 3300042606 Bacteria 1647
54 Ga0466697_029705 3300042611 Bacteria 1096
55 Ga0466703_211742 3300042636 Bacteria 1699
56 Ga0466724_64518 3300042649 Bacteria 1715
57 Ga0466725_439507 3300042654 Bacteria 4065
58 JGI24695J34938_10132045 3300002450 Bacteria 1018
59 JGI24702J35022_10166870 3300002462 Bacteria 1243
60 JGI24702J35022_10487778 3300002462 Bacteria 754
61 JGI24696J40584_12499249 3300002834 Bacteria 599
62 Ga0466715_267046 3300042616 Bacteria 4586
63 Ga0123355_10376272 3300009826 Bacteria 1855
64 Ga0123356_10488060 3300010049 Bacteria 1386
65 Ga0123356_10977042 3300010049 Bacteria 1017
66 Ga0123356_11038301 3300010049 Bacteria 989
67 Ga0123353_10000250 3300010167 Bacteria 67710
68 Ga0123353_10227087 3300010167 Bacteria 2914
69 Ga0123353_10832600 3300010167 Bacteria 1268
70 Ga0123353_11865128 3300010167 Bacteria 743
71 Ga0466699_210015 3300042597 Bacteria 2891
72 Ga0466701_013017 3300042598 Bacteria 2779
73 Ga0466700_392062 3300042600 Bacteria 2292
74 Ga0466713_000770 3300042602 Bacteria 15641
75 Ga0466713_053456 3300042602 Unclassified 1077
76 JGI24702J35022_10013264 3300002462 Bacteria 4565
77 JGI24702J35022_10043277 3300002462 Bacteria 2398
78 JGI24702J35022_10274504 3300002462 Unclassified 987
79 Ga0466697_121056 3300042611 Bacteria 1101
80 Ga0466697_174577 3300042611 Bacteria 1796
81 Ga0123356_10939418 3300010049 Bacteria 1036
82 Ga0123353_10000048 3300010167 Bacteria 132187
83 Ga0123353_10304018 3300010167 Bacteria 2433
84 Ga0123353_10495202 3300010167 Bacteria 1783
85 Ga0123353_11051622 3300010167 Bacteria 1087
86 Ga0466656_207830 3300042550 Bacteria 1944
87 Ga0466701_102044 3300042598 Unclassified 1372
88 Ga0466698_252677 3300042610 Bacteria 1694
89 Ga0466734_144924 3300042623 Bacteria 1208
90 JGI24702J35022_10679536 3300002462 Bacteria 639
91 Ga0072941_1029511 3300005201 Bacteria 4972
92 Ga0466712_053197 3300042614 Unclassified 1106
93 Ga0466729_190127 3300042621 Bacteria 2857
94 Ga0466697_222150 3300042611 Bacteria 2048
95 Ga0466733_100718 3300042659 Bacteria 45700
96 Ga0123356_10090600 3300010049 Bacteria 2912
97 Ga0123356_10097433 3300010049 Bacteria 2814
98 Ga0123356_10139548 3300010049 Bacteria 2389
99 Ga0123356_12110145 3300010049 Bacteria 704
100 Ga0123356_12877189 3300010049 Bacteria 602
101 Ga0123353_10536522 3300010167 Bacteria 1692
102 Ga0123353_11449599 3300010167 Bacteria 878
103 Ga0123353_12168348 3300010167 Unclassified 673
104 Ga0466693_223169 3300042592 Bacteria 1306
105 Ga0466695_258997 3300042595 Bacteria 3807
106 Ga0466701_017162 3300042598 Bacteria 1880
107 Ga0466701_037595 3300042598 Bacteria 2226
108 Ga0466700_039627 3300042600 Bacteria 11016
109 Ga0466714_113540 3300042603 Bacteria 1726
110 Ga0466724_59839 3300042649 Bacteria 1499
111 JGI24695J34938_10405409 3300002450 Bacteria 609
112 JGI24702J35022_10097196 3300002462 Bacteria 1608
113 Ga0466710_295334 3300042613 Unclassified 1442
114 Ga0466733_186435 3300042659 Bacteria 5029
115 Ga0123355_10000306 3300009826 Bacteria 62944
116 Ga0123355_10074513 3300009826 Bacteria 5438
117 Ga0123353_10393272 3300010167 Bacteria 2067
118 Ga0466701_068009 3300042598 Bacteria 1998
119 Ga0466701_087598 3300042598 Bacteria 1950
120 Ga0466731_151707 3300042622 Unclassified 2110
121 Ga0466731_350962 3300042622 Bacteria 1535
122 Ga0466734_071254 3300042623 Bacteria 2306
123 Ga0466734_146023 3300042623 Bacteria 1128
124 Ga0466703_288990 3300042636 Bacteria 14417
125 Ga0466724_28286 3300042649 Bacteria 1681
126 JGI24698J34947_10051115 3300002449 Unclassified 2081
127 JGI24702J35022_10054973 3300002462 Bacteria 2123
128 JGI24702J35022_10075477 3300002462 Bacteria 1821
129 JGI24702J35022_10421841 3300002462 Bacteria 809
130 JGI24696J40584_12401828 3300002834 Bacteria 555
131 Ga0466718_104539 3300042617 Bacteria 1072
132 Ga0466697_254156 3300042611 Bacteria 7318
133 Ga0123356_10110078 3300010049 Bacteria 2659
134 Ga0123356_10494899 3300010049 Unclassified 1378
135 Ga0123356_11078973 3300010049 Bacteria 972
136 Ga0123354_10299679 3300010882 Bacteria 1523
137 Ga0123354_10399399 3300010882 Bacteria 1165
138 Ga0466693_347867 3300042592 Bacteria 1042
139 Ga0466694_263162 3300042594 Bacteria 5185
140 Ga0466701_021429 3300042598 Bacteria 3330
141 Ga0466719_033481 3300042606 Bacteria 5942
142 Ga0466721_162282 3300042608 Bacteria 2938
143 Ga0466709_045775 3300042648 Bacteria 35196
144 JGI24698J34947_10015030 3300002449 Unclassified 4215
145 JGI24702J35022_10002474 3300002462 Bacteria 11275
146 JGI24702J35022_10380680 3300002462 Bacteria 849
147 JGI24696J40584_12693262 3300002834 Bacteria 731
148 JGI24696J40584_12781245 3300002834 Bacteria 837
149 JGI24696J40584_12953395 3300002834 Bacteria 2477
150 Ga0072940_1317869 3300005200 Bacteria 506
151 Ga0466710_031482 3300042613 Bacteria 1748
152 Ga0466710_269662 3300042613 Bacteria 1116

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04237 YjbR YjbR 12 101 0.94

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.