Protein Family IF06923
Metagenome
Metatranscriptome
Isolate
307
Members
115
Samples
239
Scaffolds
230.93
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_026641|Ga0466698_026641_498_1193
- Length
- 219 aa
- Sequence
- MKRGKKYLEKAKLIEKMKLYDVPDAIDLVQKTTVAKFDETIEAHIRLGVDSRHADQQVRGAVVLPHGTGKKVRVLVFAKADKAAEALVAKIQNENWFEFDVVVATPDMMGVVGRIGRVLGPKGLMPNPKAGTVTADVAKAVTDIKAGKIEYRLDKTNIIHVPLGKVSFGSEKLNENFSTLMSAVIKAKPAAAKGTYLRSVVLACTMGPGVRVNTLRISE
Sample Types
Isolate
22.1%
Metagenome
77.5%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
62.3%
Termitidae
23.7%
Kalotermitidae
7.9%
Passalidae
1.8%
Rhinotermitidae
1.8%
Termopsidae
1.8%
Hodotermitidae
0.9%
Taxonomy
Archaea
0
Bacteria
288
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 3 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 4 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 5 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 6 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 7 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 8 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 9 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 10 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 11 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 12 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 13 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 2820242869 | Unclassified Firmicutes Th196P3bin82 | Isolate | Unclassified |
| 16 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 17 | 2820467504 | Unclassified Firmicutes Lab288P3bin1 | Isolate | Unclassified |
| 18 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 19 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 20 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 21 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 22 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 23 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 33 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 34 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 35 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 36 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 37 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 38 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 39 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 40 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 41 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 42 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 47 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 48 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 49 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 50 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 51 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 52 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 53 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 54 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 55 | 2820581541 | Unclassified Firmicutes Emb289P3bin127 | Isolate | Unclassified |
| 56 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 57 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 58 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 59 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 60 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 61 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 62 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 63 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 64 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 65 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 66 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 67 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 68 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 69 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 70 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 71 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 72 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 73 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 74 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 75 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 76 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 77 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 78 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 79 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 80 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 81 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 82 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 83 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 84 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 85 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 86 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 87 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 88 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 89 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 90 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 91 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 92 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 93 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 94 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 95 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 96 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 97 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 98 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 99 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 100 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 101 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 102 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 103 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 104 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 105 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 106 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 107 | 2820592308 | Unclassified Firmicutes Emb289P1bin71 | Isolate | Unclassified |
| 108 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 109 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 110 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 111 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 112 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 113 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 114 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 115 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10048533 | 3300009784 | Bacteria | 5753 |
| 2 | Ga0123355_10000818 | 3300009826 | Bacteria | 42687 |
| 3 | Ga0123355_10001243 | 3300009826 | Bacteria | 35541 |
| 4 | Ga0123355_10009798 | 3300009826 | Bacteria | 14616 |
| 5 | Ga0123355_10030462 | 3300009826 | Bacteria | 8744 |
| 6 | Ga0123355_10259283 | 3300009826 | Bacteria | 2434 |
| 7 | Ga0123355_10483509 | 3300009826 | Unclassified | 1539 |
| 8 | Ga0123355_11172648 | 3300009826 | Bacteria | 788 |
| 9 | Ga0123356_10800384 | 3300010049 | Bacteria | 1114 |
| 10 | Ga0466729_312144 | 3300042621 | Bacteria | 3207 |
| 11 | Ga0466702_156018 | 3300042635 | Bacteria | 3839 |
| 12 | Ga0466703_296081 | 3300042636 | Bacteria | 8774 |
| 13 | Ga0466725_050568 | 3300042654 | Bacteria | 1923 |
| 14 | Ga0415639_048987 | 3300038395 | Bacteria | 9468 |
| 15 | Ga0466690_262986 | 3300042590 | Bacteria | 10509 |
| 16 | Ga0466700_385119 | 3300042600 | Bacteria | 8112 |
| 17 | Ga0466714_153352 | 3300042603 | Bacteria | 14468 |
| 18 | Ga0466719_062453 | 3300042606 | Bacteria | 18088 |
| 19 | IMNBL1DRAFT_c0000215 | 3300000062 | Bacteria | 50630 |
| 20 | IMNBL1DRAFT_c0001883 | 3300000062 | Bacteria | 15269 |
| 21 | IMNBL1DRAFT_c0002473 | 3300000062 | Bacteria | 12843 |
| 22 | JGI24703J35330_11510916 | 3300002501 | Unclassified | 1137 |
| 23 | JGI24703J35330_11740874 | 3300002501 | Bacteria | 3468 |
| 24 | JGI24703J35330_11748681 | 3300002501 | Bacteria | 24743 |
| 25 | JGI24705J35276_12231478 | 3300002504 | Bacteria | 3954 |
| 26 | JGI24700J35501_10930718 | 3300002508 | Bacteria | 19773 |
| 27 | Ga0466715_160590 | 3300042616 | Bacteria | 34416 |
| 28 | Ga0123357_10216328 | 3300009784 | Bacteria | 2138 |
| 29 | Ga0123355_10000403 | 3300009826 | Bacteria | 56359 |
| 30 | Ga0123355_10000841 | 3300009826 | Bacteria | 42251 |
| 31 | Ga0123355_10002193 | 3300009826 | Bacteria | 27549 |
| 32 | Ga0123355_10152341 | 3300009826 | Bacteria | 3509 |
| 33 | Ga0123355_10170523 | 3300009826 | Unclassified | 3254 |
| 34 | Ga0123355_10308097 | 3300009826 | Bacteria | 2150 |
| 35 | Ga0123355_10415909 | 3300009826 | Bacteria | 1722 |
| 36 | Ga0123355_10461592 | 3300009826 | Unclassified | 1593 |
| 37 | Ga0123355_10478098 | 3300009826 | Bacteria | 1552 |
| 38 | Ga0123355_10674234 | 3300009826 | Bacteria | 1197 |
| 39 | Ga0123355_10907137 | 3300009826 | Bacteria | 956 |
| 40 | Ga0123356_10007167 | 3300010049 | Bacteria | 11162 |
| 41 | Ga0123356_11480227 | 3300010049 | Bacteria | 837 |
| 42 | Ga0123353_10078333 | 3300010167 | Bacteria | 5312 |
| 43 | Ga0123354_10247765 | 3300010882 | Bacteria | 1814 |
| 44 | Ga0466735_103877 | 3300042624 | Bacteria | 1361 |
| 45 | Ga0466702_076775 | 3300042635 | Bacteria | 5227 |
| 46 | Ga0466702_118657 | 3300042635 | Bacteria | 1159 |
| 47 | Ga0466702_352245 | 3300042635 | Bacteria | 1107 |
| 48 | Ga0466703_289135 | 3300042636 | Bacteria | 16050 |
| 49 | Ga0466725_065016 | 3300042654 | Bacteria | 3187 |
| 50 | Ga0466725_170215 | 3300042654 | Bacteria | 2316 |
| 51 | Ga0466725_389558 | 3300042654 | Unclassified | 4020 |
| 52 | Ga0466690_182750 | 3300042590 | Bacteria | 24839 |
| 53 | Ga0466706_277943 | 3300042599 | Bacteria | 1188 |
| 54 | Ga0466714_020081 | 3300042603 | Bacteria | 30959 |
| 55 | Ga0466714_133706 | 3300042603 | Bacteria | 11876 |
| 56 | Ga0466722_148528 | 3300042609 | Bacteria | 1645 |
| 57 | Ga0466698_274405 | 3300042610 | Bacteria | 1202 |
| 58 | 2227247441 | 2225789004 | Bacteria | 32698 |
| 59 | JGI24695J34938_10000131 | 3300002450 | Bacteria | 67838 |
| 60 | JGI24702J35022_10035348 | 3300002462 | Bacteria | 2672 |
| 61 | Ga0123357_10002664 | 3300009784 | Bacteria | 20090 |
| 62 | Ga0466711_052085 | 3300042615 | Bacteria | 1427 |
| 63 | Ga0466711_240555 | 3300042615 | Bacteria | 24047 |
| 64 | Ga0466715_179330 | 3300042616 | Bacteria | 10783 |
| 65 | Ga0466705_113733 | 3300042612 | Bacteria | 4879 |
| 66 | Ga0466705_209053 | 3300042612 | Bacteria | 327332 |
| 67 | Ga0123355_10025839 | 3300009826 | Bacteria | 9460 |
| 68 | Ga0123355_10045440 | 3300009826 | Bacteria | 7144 |
| 69 | Ga0123355_10056880 | 3300009826 | Bacteria | 6331 |
| 70 | Ga0123355_10185420 | 3300009826 | Bacteria | 3078 |
| 71 | Ga0123355_10272984 | 3300009826 | Unclassified | 2346 |
| 72 | Ga0123355_10274109 | 3300009826 | Unclassified | 2339 |
| 73 | Ga0123355_10382656 | 3300009826 | Bacteria | 1832 |
| 74 | Ga0123356_10056886 | 3300010049 | Bacteria | 3644 |
| 75 | Ga0123356_11264174 | 3300010049 | Bacteria | 902 |
| 76 | Ga0123353_10046443 | 3300010167 | Bacteria | 6901 |
| 77 | Ga0123353_10107820 | 3300010167 | Bacteria | 4489 |
| 78 | Ga0123353_10184311 | 3300010167 | Unclassified | 3302 |
| 79 | Ga0123353_10272409 | 3300010167 | Bacteria | 2607 |
| 80 | Ga0123354_10427780 | 3300010882 | Bacteria | 1093 |
| 81 | Ga0466731_087692 | 3300042622 | Bacteria | 2713 |
| 82 | Ga0466734_010247 | 3300042623 | Bacteria | 1780 |
| 83 | Ga0466734_061498 | 3300042623 | Bacteria | 1503 |
| 84 | Ga0466702_174357 | 3300042635 | Bacteria | 2338 |
| 85 | Ga0466702_285214 | 3300042635 | Bacteria | 1830 |
| 86 | Ga0466714_139014 | 3300042603 | Unclassified | 1441 |
| 87 | Ga0466719_184727 | 3300042606 | Bacteria | 1811 |
| 88 | Ga0466719_531656 | 3300042606 | Bacteria | 2809 |
| 89 | Ga0466722_232480 | 3300042609 | Bacteria | 4914 |
| 90 | IMNBL1DRAFT_c0000348 | 3300000062 | Bacteria | 39017 |
| 91 | IMNBL1DRAFT_c0000422 | 3300000062 | Bacteria | 35538 |
| 92 | JGI24695J34938_10067146 | 3300002450 | Bacteria | 1510 |
| 93 | JGI24700J35501_10930006 | 3300002508 | Bacteria | 10975 |
| 94 | JGI24700J35501_10930217 | 3300002508 | Bacteria | 12223 |
| 95 | Ga0068305_10022207 | 3300005083 | Unclassified | 11021 |
| 96 | Ga0466711_165617 | 3300042615 | Bacteria | 2870 |
| 97 | Ga0466715_160271 | 3300042616 | Bacteria | 60659 |
| 98 | Ga0466715_538227 | 3300042616 | Bacteria | 4048 |
| 99 | Ga0123355_10022605 | 3300009826 | Bacteria | 10082 |
| 100 | Ga0123355_10035166 | 3300009826 | Bacteria | 8145 |
| 101 | Ga0123355_10176018 | 3300009826 | Bacteria | 3186 |
| 102 | Ga0123355_10231039 | 3300009826 | Bacteria | 2641 |
| 103 | Ga0123355_10284639 | 3300009826 | Bacteria | 2277 |
| 104 | Ga0123355_10427630 | 3300009826 | Bacteria | 1687 |
| 105 | Ga0123353_10015960 | 3300010167 | Bacteria | 10952 |
| 106 | Ga0123353_10603209 | 3300010167 | Bacteria | 1568 |
| 107 | Ga0466702_165589 | 3300042635 | Bacteria | 1941 |
| 108 | Ga0466704_459191 | 3300042643 | Bacteria | 1483 |
| 109 | Ga0223683_1001285 | 3300021245 | Bacteria | 1021 |
| 110 | Ga0466693_202159 | 3300042592 | Bacteria | 1217 |
| 111 | Ga0466706_231926 | 3300042599 | Bacteria | 55121 |
| 112 | Ga0466714_163756 | 3300042603 | Bacteria | 1252 |
| 113 | 2227605187 | 2225789004 | Bacteria | 12243 |
| 114 | 2227646819 | 2225789004 | Bacteria | 44364 |
| 115 | IMNBL1DRAFT_c0003434 | 3300000062 | Bacteria | 10189 |
| 116 | Ga0466711_291082 | 3300042615 | Bacteria | 1157 |
| 117 | Ga0466697_111949 | 3300042611 | Bacteria | 2116 |
| 118 | Ga0466733_083610 | 3300042659 | Bacteria | 33057 |
| 119 | Ga0123357_10182762 | 3300009784 | Bacteria | 2442 |
| 120 | Ga0123355_10003509 | 3300009826 | Bacteria | 22512 |
| 121 | Ga0123355_10010335 | 3300009826 | Bacteria | 14291 |
| 122 | Ga0123355_10069138 | 3300009826 | Bacteria | 5677 |
| 123 | Ga0123355_10103118 | 3300009826 | Unclassified | 4485 |
| 124 | Ga0123355_10142878 | 3300009826 | Bacteria | 3657 |
| 125 | Ga0123355_10153166 | 3300009826 | Bacteria | 3495 |
| 126 | Ga0123355_10621910 | 3300009826 | Bacteria | 1272 |
| 127 | Ga0123356_10481145 | 3300010049 | Unclassified | 1394 |
| 128 | Ga0123356_10488376 | 3300010049 | Bacteria | 1385 |
| 129 | Ga0123353_10033919 | 3300010167 | Bacteria | 7956 |
| 130 | Ga0123353_10065975 | 3300010167 | Bacteria | 5810 |
| 131 | Ga0123353_10098860 | 3300010167 | Bacteria | 4703 |
| 132 | Ga0123353_10172454 | 3300010167 | Bacteria | 3432 |
| 133 | Ga0123353_10532168 | 3300010167 | Bacteria | 1701 |
| 134 | Ga0123353_10722810 | 3300010167 | Bacteria | 1392 |
| 135 | Ga0466729_287045 | 3300042621 | Bacteria | 99069 |
| 136 | Ga0466709_197752 | 3300042648 | Bacteria | 11063 |
| 137 | Ga0466693_329117 | 3300042592 | Bacteria | 2470 |
| 138 | Ga0466706_000214 | 3300042599 | Bacteria | 12862 |
| 139 | Ga0466706_037699 | 3300042599 | Bacteria | 7965 |
| 140 | Ga0466706_058846 | 3300042599 | Bacteria | 2893 |
| 141 | Ga0466706_086008 | 3300042599 | Unclassified | 4715 |
| 142 | Ga0466700_180162 | 3300042600 | Bacteria | 2267 |
| 143 | Ga0466714_060681 | 3300042603 | Bacteria | 2154 |
| 144 | Ga0466719_086516 | 3300042606 | Bacteria | 1420 |
| 145 | Ga0466722_080885 | 3300042609 | Bacteria | 53116 |
| 146 | Ga0466698_473111 | 3300042610 | Bacteria | 15959 |
| 147 | IMNBL1DRAFT_c0007273 | 3300000062 | Bacteria | 5858 |
| 148 | JGI24695J34938_10087972 | 3300002450 | Bacteria | 1277 |
| 149 | JGI24703J35330_11734611 | 3300002501 | Bacteria | 2918 |
| 150 | Ga0466697_255460 | 3300042611 | Bacteria | 6949 |
| 151 | Ga0123355_10005253 | 3300009826 | Bacteria | 18916 |
| 152 | Ga0123355_10088014 | 3300009826 | Bacteria | 4934 |
| 153 | Ga0123355_10127954 | 3300009826 | Bacteria | 3920 |
| 154 | Ga0123355_10474934 | 3300009826 | Unclassified | 1559 |
| 155 | Ga0123355_11203825 | 3300009826 | Bacteria | 773 |
| 156 | Ga0123353_10125153 | 3300010167 | Bacteria | 4131 |
| 157 | Ga0123353_10588833 | 3300010167 | Bacteria | 1593 |
| 158 | Ga0123354_10025166 | 3300010882 | Bacteria | 9386 |
| 159 | Ga0466706_133350 | 3300042599 | Bacteria | 1773 |
| 160 | Ga0466700_352776 | 3300042600 | Bacteria | 1199 |
| 161 | Ga0466713_138385 | 3300042602 | Bacteria | 336961 |
| 162 | Ga0466714_026333 | 3300042603 | Bacteria | 2358 |
| 163 | Ga0466714_070375 | 3300042603 | Bacteria | 1035 |
| 164 | Ga0466721_251509 | 3300042608 | Bacteria | 170691 |
| 165 | Ga0466722_190194 | 3300042609 | Bacteria | 120622 |
| 166 | 2227097473 | 2225789004 | Bacteria | 9697 |
| 167 | JGI24702J35022_10000123 | 3300002462 | Bacteria | 37729 |
| 168 | JGI24702J35022_10044744 | 3300002462 | Bacteria | 2359 |
| 169 | JGI24700J35501_10929137 | 3300002508 | Bacteria | 8670 |
| 170 | Ga0466715_558368 | 3300042616 | Bacteria | 2675 |
| 171 | Ga0466718_119911 | 3300042617 | Bacteria | 1418 |
| 172 | Ga0466705_007537 | 3300042612 | Bacteria | 9476 |
| 173 | Ga0123355_10000760 | 3300009826 | Bacteria | 44056 |
| 174 | Ga0123355_10142211 | 3300009826 | Bacteria | 3668 |
| 175 | Ga0123355_10260093 | 3300009826 | Bacteria | 2428 |
| 176 | Ga0123355_10317096 | 3300009826 | Bacteria | 2105 |
| 177 | Ga0123355_10327781 | 3300009826 | Bacteria | 2055 |
| 178 | Ga0123355_10646934 | 3300009826 | Unclassified | 1235 |
| 179 | Ga0123355_10705395 | 3300009826 | Bacteria | 1157 |
| 180 | Ga0123355_11172032 | 3300009826 | Bacteria | 788 |
| 181 | Ga0123356_10843255 | 3300010049 | Unclassified | 1088 |
| 182 | Ga0123356_10955574 | 3300010049 | Bacteria | 1028 |
| 183 | Ga0123356_11040270 | 3300010049 | Bacteria | 988 |
| 184 | Ga0123353_10000065 | 3300010167 | Bacteria | 116079 |
| 185 | Ga0466702_140007 | 3300042635 | Bacteria | 37921 |
| 186 | Ga0466702_408644 | 3300042635 | Bacteria | 1509 |
| 187 | Ga0466704_076757 | 3300042643 | Bacteria | 271570 |
| 188 | Ga0466704_517179 | 3300042643 | Bacteria | 15146 |
| 189 | Ga0415639_010391 | 3300038395 | Bacteria | 23566 |
| 190 | Ga0415639_015003 | 3300038395 | Bacteria | 22712 |
| 191 | Ga0466693_396004 | 3300042592 | Bacteria | 1130 |
| 192 | Ga0466695_182539 | 3300042595 | Bacteria | 3552 |
| 193 | Ga0466696_357208 | 3300042596 | Bacteria | 5389 |
| 194 | Ga0466706_093556 | 3300042599 | Unclassified | 1940 |
| 195 | Ga0466713_020224 | 3300042602 | Bacteria | 3841 |
| 196 | Ga0466713_084880 | 3300042602 | Bacteria | 1677 |
| 197 | Ga0466714_018261 | 3300042603 | Bacteria | 19225 |
| 198 | Ga0466714_029651 | 3300042603 | Bacteria | 12987 |
| 199 | Ga0466714_062311 | 3300042603 | Bacteria | 2984 |
| 200 | Ga0466714_072767 | 3300042603 | Bacteria | 3536 |
| 201 | IMNBL1DRAFT_c0000036 | 3300000062 | Bacteria | 120012 |
| 202 | Ga0466715_514495 | 3300042616 | Bacteria | 1102 |
| 203 | Ga0466705_197616 | 3300042612 | Bacteria | 10619 |
| 204 | Ga0123357_10147846 | 3300009784 | Bacteria | 2863 |
| 205 | Ga0123357_10287581 | 3300009784 | Bacteria | 1685 |
| 206 | Ga0123357_10466307 | 3300009784 | Bacteria | 1081 |
| 207 | Ga0123355_10001030 | 3300009826 | Bacteria | 38630 |
| 208 | Ga0123355_10186206 | 3300009826 | Unclassified | 3069 |
| 209 | Ga0123355_10201572 | 3300009826 | Bacteria | 2905 |
| 210 | Ga0123355_10210501 | 3300009826 | Bacteria | 2819 |
| 211 | Ga0123355_10216444 | 3300009826 | Bacteria | 2764 |
| 212 | Ga0123355_10476724 | 3300009826 | Bacteria | 1555 |
| 213 | Ga0123356_10464763 | 3300010049 | Bacteria | 1416 |
| 214 | Ga0123353_10287094 | 3300010167 | Bacteria | 2522 |
| 215 | Ga0466731_229705 | 3300042622 | Unclassified | 1394 |
| 216 | Ga0466704_005432 | 3300042643 | Bacteria | 1408 |
| 217 | Ga0466704_562831 | 3300042643 | Bacteria | 2440 |
| 218 | Ga0466724_36372 | 3300042649 | Bacteria | 3322 |
| 219 | Ga0466724_65186 | 3300042649 | Bacteria | 1460 |
| 220 | Ga0415639_004191 | 3300038395 | Bacteria | 37294 |
| 221 | Ga0466693_126331 | 3300042592 | Bacteria | 1354 |
| 222 | Ga0466706_251547 | 3300042599 | Bacteria | 84388 |
| 223 | Ga0466707_408529 | 3300042601 | Bacteria | 5410 |
| 224 | Ga0466713_094626 | 3300042602 | Bacteria | 5782 |
| 225 | Ga0466714_071834 | 3300042603 | Bacteria | 2041 |
| 226 | Ga0466714_077117 | 3300042603 | Bacteria | 6747 |
| 227 | Ga0466714_134158 | 3300042603 | Bacteria | 2615 |
| 228 | Ga0466722_107443 | 3300042609 | Bacteria | 1676 |
| 229 | Ga0466698_026641 | 3300042610 | Bacteria | 1263 |
| 230 | 2227386345 | 2225789004 | Bacteria | 27406 |
| 231 | 2227477397 | 2225789004 | Bacteria | 22581 |
| 232 | IMNBL1DRAFT_c0003667 | 3300000062 | Bacteria | 9684 |
| 233 | JGI24702J35022_10099322 | 3300002462 | Bacteria | 1592 |
| 234 | JGI24702J35022_10323320 | 3300002462 | Bacteria | 916 |
| 235 | JGI24697J35500_11274903 | 3300002507 | Bacteria | 12544 |
| 236 | Ga0072941_1001152 | 3300005201 | Bacteria | 56124 |
| 237 | Ga0072941_1005122 | 3300005201 | Bacteria | 10650 |
| 238 | Ga0466715_387240 | 3300042616 | Bacteria | 1977 |
| 239 | Ga0466726_211281 | 3300042619 | Bacteria | 2244 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00687 | Ribosomal_L1 | Ribosomal protein L1p/L10e family | 30 | 208 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.