Protein Family IF06923

Metagenome Metatranscriptome Isolate
307 Members
115 Samples
239 Scaffolds
230.93 Avg Length

🧬 Representative Sequence

ID
3300042610|Ga0466698_026641|Ga0466698_026641_498_1193
Length
219 aa
Sequence
MKRGKKYLEKAKLIEKMKLYDVPDAIDLVQKTTVAKFDETIEAHIRLGVDSRHADQQVRGAVVLPHGTGKKVRVLVFAKADKAAEALVAKIQNENWFEFDVVVATPDMMGVVGRIGRVLGPKGLMPNPKAGTVTADVAKAVTDIKAGKIEYRLDKTNIIHVPLGKVSFGSEKLNENFSTLMSAVIKAKPAAAKGTYLRSVVLACTMGPGVRVNTLRISE

πŸ“Š Sample Types

Isolate 22.1%
Metagenome 77.5%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 62.3%
Termitidae 23.7%
Kalotermitidae 7.9%
Passalidae 1.8%
Rhinotermitidae 1.8%
Termopsidae 1.8%
Hodotermitidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 288
Eukaryota 0
Viruses 0
Unclassified 19

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
3 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
4 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
5 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
6 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
7 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
8 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
9 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
10 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
11 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
12 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
13 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
16 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
17 2820467504 Unclassified Firmicutes Lab288P3bin1 Isolate Unclassified
18 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
19 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
20 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
21 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
22 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
23 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
26 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
33 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
34 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
35 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
36 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
37 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
38 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
39 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
40 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
41 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
42 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
43 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
44 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
45 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
46 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
47 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
48 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
49 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
50 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
51 2820455747 Unclassified Firmicutes Lab288P3bin160 Isolate Unclassified
52 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
53 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
54 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
55 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
56 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
57 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
58 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
59 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
60 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
61 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
62 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
63 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
64 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
65 3300021245 Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA Metatranscriptome Termitidae
66 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
67 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
68 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
69 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
70 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
71 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
72 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
73 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
74 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
75 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
76 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
77 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
78 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
79 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
80 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
81 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
82 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
83 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
84 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
85 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
86 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
87 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
88 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
89 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
90 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
91 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
92 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
93 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
94 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
95 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
96 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
97 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
98 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
99 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
100 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
101 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
102 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
103 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
104 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
105 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
106 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
107 2820592308 Unclassified Firmicutes Emb289P1bin71 Isolate Unclassified
108 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
109 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
110 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
111 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
112 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
113 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
114 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
115 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10048533 3300009784 Bacteria 5753
2 Ga0123355_10000818 3300009826 Bacteria 42687
3 Ga0123355_10001243 3300009826 Bacteria 35541
4 Ga0123355_10009798 3300009826 Bacteria 14616
5 Ga0123355_10030462 3300009826 Bacteria 8744
6 Ga0123355_10259283 3300009826 Bacteria 2434
7 Ga0123355_10483509 3300009826 Unclassified 1539
8 Ga0123355_11172648 3300009826 Bacteria 788
9 Ga0123356_10800384 3300010049 Bacteria 1114
10 Ga0466729_312144 3300042621 Bacteria 3207
11 Ga0466702_156018 3300042635 Bacteria 3839
12 Ga0466703_296081 3300042636 Bacteria 8774
13 Ga0466725_050568 3300042654 Bacteria 1923
14 Ga0415639_048987 3300038395 Bacteria 9468
15 Ga0466690_262986 3300042590 Bacteria 10509
16 Ga0466700_385119 3300042600 Bacteria 8112
17 Ga0466714_153352 3300042603 Bacteria 14468
18 Ga0466719_062453 3300042606 Bacteria 18088
19 IMNBL1DRAFT_c0000215 3300000062 Bacteria 50630
20 IMNBL1DRAFT_c0001883 3300000062 Bacteria 15269
21 IMNBL1DRAFT_c0002473 3300000062 Bacteria 12843
22 JGI24703J35330_11510916 3300002501 Unclassified 1137
23 JGI24703J35330_11740874 3300002501 Bacteria 3468
24 JGI24703J35330_11748681 3300002501 Bacteria 24743
25 JGI24705J35276_12231478 3300002504 Bacteria 3954
26 JGI24700J35501_10930718 3300002508 Bacteria 19773
27 Ga0466715_160590 3300042616 Bacteria 34416
28 Ga0123357_10216328 3300009784 Bacteria 2138
29 Ga0123355_10000403 3300009826 Bacteria 56359
30 Ga0123355_10000841 3300009826 Bacteria 42251
31 Ga0123355_10002193 3300009826 Bacteria 27549
32 Ga0123355_10152341 3300009826 Bacteria 3509
33 Ga0123355_10170523 3300009826 Unclassified 3254
34 Ga0123355_10308097 3300009826 Bacteria 2150
35 Ga0123355_10415909 3300009826 Bacteria 1722
36 Ga0123355_10461592 3300009826 Unclassified 1593
37 Ga0123355_10478098 3300009826 Bacteria 1552
38 Ga0123355_10674234 3300009826 Bacteria 1197
39 Ga0123355_10907137 3300009826 Bacteria 956
40 Ga0123356_10007167 3300010049 Bacteria 11162
41 Ga0123356_11480227 3300010049 Bacteria 837
42 Ga0123353_10078333 3300010167 Bacteria 5312
43 Ga0123354_10247765 3300010882 Bacteria 1814
44 Ga0466735_103877 3300042624 Bacteria 1361
45 Ga0466702_076775 3300042635 Bacteria 5227
46 Ga0466702_118657 3300042635 Bacteria 1159
47 Ga0466702_352245 3300042635 Bacteria 1107
48 Ga0466703_289135 3300042636 Bacteria 16050
49 Ga0466725_065016 3300042654 Bacteria 3187
50 Ga0466725_170215 3300042654 Bacteria 2316
51 Ga0466725_389558 3300042654 Unclassified 4020
52 Ga0466690_182750 3300042590 Bacteria 24839
53 Ga0466706_277943 3300042599 Bacteria 1188
54 Ga0466714_020081 3300042603 Bacteria 30959
55 Ga0466714_133706 3300042603 Bacteria 11876
56 Ga0466722_148528 3300042609 Bacteria 1645
57 Ga0466698_274405 3300042610 Bacteria 1202
58 2227247441 2225789004 Bacteria 32698
59 JGI24695J34938_10000131 3300002450 Bacteria 67838
60 JGI24702J35022_10035348 3300002462 Bacteria 2672
61 Ga0123357_10002664 3300009784 Bacteria 20090
62 Ga0466711_052085 3300042615 Bacteria 1427
63 Ga0466711_240555 3300042615 Bacteria 24047
64 Ga0466715_179330 3300042616 Bacteria 10783
65 Ga0466705_113733 3300042612 Bacteria 4879
66 Ga0466705_209053 3300042612 Bacteria 327332
67 Ga0123355_10025839 3300009826 Bacteria 9460
68 Ga0123355_10045440 3300009826 Bacteria 7144
69 Ga0123355_10056880 3300009826 Bacteria 6331
70 Ga0123355_10185420 3300009826 Bacteria 3078
71 Ga0123355_10272984 3300009826 Unclassified 2346
72 Ga0123355_10274109 3300009826 Unclassified 2339
73 Ga0123355_10382656 3300009826 Bacteria 1832
74 Ga0123356_10056886 3300010049 Bacteria 3644
75 Ga0123356_11264174 3300010049 Bacteria 902
76 Ga0123353_10046443 3300010167 Bacteria 6901
77 Ga0123353_10107820 3300010167 Bacteria 4489
78 Ga0123353_10184311 3300010167 Unclassified 3302
79 Ga0123353_10272409 3300010167 Bacteria 2607
80 Ga0123354_10427780 3300010882 Bacteria 1093
81 Ga0466731_087692 3300042622 Bacteria 2713
82 Ga0466734_010247 3300042623 Bacteria 1780
83 Ga0466734_061498 3300042623 Bacteria 1503
84 Ga0466702_174357 3300042635 Bacteria 2338
85 Ga0466702_285214 3300042635 Bacteria 1830
86 Ga0466714_139014 3300042603 Unclassified 1441
87 Ga0466719_184727 3300042606 Bacteria 1811
88 Ga0466719_531656 3300042606 Bacteria 2809
89 Ga0466722_232480 3300042609 Bacteria 4914
90 IMNBL1DRAFT_c0000348 3300000062 Bacteria 39017
91 IMNBL1DRAFT_c0000422 3300000062 Bacteria 35538
92 JGI24695J34938_10067146 3300002450 Bacteria 1510
93 JGI24700J35501_10930006 3300002508 Bacteria 10975
94 JGI24700J35501_10930217 3300002508 Bacteria 12223
95 Ga0068305_10022207 3300005083 Unclassified 11021
96 Ga0466711_165617 3300042615 Bacteria 2870
97 Ga0466715_160271 3300042616 Bacteria 60659
98 Ga0466715_538227 3300042616 Bacteria 4048
99 Ga0123355_10022605 3300009826 Bacteria 10082
100 Ga0123355_10035166 3300009826 Bacteria 8145
101 Ga0123355_10176018 3300009826 Bacteria 3186
102 Ga0123355_10231039 3300009826 Bacteria 2641
103 Ga0123355_10284639 3300009826 Bacteria 2277
104 Ga0123355_10427630 3300009826 Bacteria 1687
105 Ga0123353_10015960 3300010167 Bacteria 10952
106 Ga0123353_10603209 3300010167 Bacteria 1568
107 Ga0466702_165589 3300042635 Bacteria 1941
108 Ga0466704_459191 3300042643 Bacteria 1483
109 Ga0223683_1001285 3300021245 Bacteria 1021
110 Ga0466693_202159 3300042592 Bacteria 1217
111 Ga0466706_231926 3300042599 Bacteria 55121
112 Ga0466714_163756 3300042603 Bacteria 1252
113 2227605187 2225789004 Bacteria 12243
114 2227646819 2225789004 Bacteria 44364
115 IMNBL1DRAFT_c0003434 3300000062 Bacteria 10189
116 Ga0466711_291082 3300042615 Bacteria 1157
117 Ga0466697_111949 3300042611 Bacteria 2116
118 Ga0466733_083610 3300042659 Bacteria 33057
119 Ga0123357_10182762 3300009784 Bacteria 2442
120 Ga0123355_10003509 3300009826 Bacteria 22512
121 Ga0123355_10010335 3300009826 Bacteria 14291
122 Ga0123355_10069138 3300009826 Bacteria 5677
123 Ga0123355_10103118 3300009826 Unclassified 4485
124 Ga0123355_10142878 3300009826 Bacteria 3657
125 Ga0123355_10153166 3300009826 Bacteria 3495
126 Ga0123355_10621910 3300009826 Bacteria 1272
127 Ga0123356_10481145 3300010049 Unclassified 1394
128 Ga0123356_10488376 3300010049 Bacteria 1385
129 Ga0123353_10033919 3300010167 Bacteria 7956
130 Ga0123353_10065975 3300010167 Bacteria 5810
131 Ga0123353_10098860 3300010167 Bacteria 4703
132 Ga0123353_10172454 3300010167 Bacteria 3432
133 Ga0123353_10532168 3300010167 Bacteria 1701
134 Ga0123353_10722810 3300010167 Bacteria 1392
135 Ga0466729_287045 3300042621 Bacteria 99069
136 Ga0466709_197752 3300042648 Bacteria 11063
137 Ga0466693_329117 3300042592 Bacteria 2470
138 Ga0466706_000214 3300042599 Bacteria 12862
139 Ga0466706_037699 3300042599 Bacteria 7965
140 Ga0466706_058846 3300042599 Bacteria 2893
141 Ga0466706_086008 3300042599 Unclassified 4715
142 Ga0466700_180162 3300042600 Bacteria 2267
143 Ga0466714_060681 3300042603 Bacteria 2154
144 Ga0466719_086516 3300042606 Bacteria 1420
145 Ga0466722_080885 3300042609 Bacteria 53116
146 Ga0466698_473111 3300042610 Bacteria 15959
147 IMNBL1DRAFT_c0007273 3300000062 Bacteria 5858
148 JGI24695J34938_10087972 3300002450 Bacteria 1277
149 JGI24703J35330_11734611 3300002501 Bacteria 2918
150 Ga0466697_255460 3300042611 Bacteria 6949
151 Ga0123355_10005253 3300009826 Bacteria 18916
152 Ga0123355_10088014 3300009826 Bacteria 4934
153 Ga0123355_10127954 3300009826 Bacteria 3920
154 Ga0123355_10474934 3300009826 Unclassified 1559
155 Ga0123355_11203825 3300009826 Bacteria 773
156 Ga0123353_10125153 3300010167 Bacteria 4131
157 Ga0123353_10588833 3300010167 Bacteria 1593
158 Ga0123354_10025166 3300010882 Bacteria 9386
159 Ga0466706_133350 3300042599 Bacteria 1773
160 Ga0466700_352776 3300042600 Bacteria 1199
161 Ga0466713_138385 3300042602 Bacteria 336961
162 Ga0466714_026333 3300042603 Bacteria 2358
163 Ga0466714_070375 3300042603 Bacteria 1035
164 Ga0466721_251509 3300042608 Bacteria 170691
165 Ga0466722_190194 3300042609 Bacteria 120622
166 2227097473 2225789004 Bacteria 9697
167 JGI24702J35022_10000123 3300002462 Bacteria 37729
168 JGI24702J35022_10044744 3300002462 Bacteria 2359
169 JGI24700J35501_10929137 3300002508 Bacteria 8670
170 Ga0466715_558368 3300042616 Bacteria 2675
171 Ga0466718_119911 3300042617 Bacteria 1418
172 Ga0466705_007537 3300042612 Bacteria 9476
173 Ga0123355_10000760 3300009826 Bacteria 44056
174 Ga0123355_10142211 3300009826 Bacteria 3668
175 Ga0123355_10260093 3300009826 Bacteria 2428
176 Ga0123355_10317096 3300009826 Bacteria 2105
177 Ga0123355_10327781 3300009826 Bacteria 2055
178 Ga0123355_10646934 3300009826 Unclassified 1235
179 Ga0123355_10705395 3300009826 Bacteria 1157
180 Ga0123355_11172032 3300009826 Bacteria 788
181 Ga0123356_10843255 3300010049 Unclassified 1088
182 Ga0123356_10955574 3300010049 Bacteria 1028
183 Ga0123356_11040270 3300010049 Bacteria 988
184 Ga0123353_10000065 3300010167 Bacteria 116079
185 Ga0466702_140007 3300042635 Bacteria 37921
186 Ga0466702_408644 3300042635 Bacteria 1509
187 Ga0466704_076757 3300042643 Bacteria 271570
188 Ga0466704_517179 3300042643 Bacteria 15146
189 Ga0415639_010391 3300038395 Bacteria 23566
190 Ga0415639_015003 3300038395 Bacteria 22712
191 Ga0466693_396004 3300042592 Bacteria 1130
192 Ga0466695_182539 3300042595 Bacteria 3552
193 Ga0466696_357208 3300042596 Bacteria 5389
194 Ga0466706_093556 3300042599 Unclassified 1940
195 Ga0466713_020224 3300042602 Bacteria 3841
196 Ga0466713_084880 3300042602 Bacteria 1677
197 Ga0466714_018261 3300042603 Bacteria 19225
198 Ga0466714_029651 3300042603 Bacteria 12987
199 Ga0466714_062311 3300042603 Bacteria 2984
200 Ga0466714_072767 3300042603 Bacteria 3536
201 IMNBL1DRAFT_c0000036 3300000062 Bacteria 120012
202 Ga0466715_514495 3300042616 Bacteria 1102
203 Ga0466705_197616 3300042612 Bacteria 10619
204 Ga0123357_10147846 3300009784 Bacteria 2863
205 Ga0123357_10287581 3300009784 Bacteria 1685
206 Ga0123357_10466307 3300009784 Bacteria 1081
207 Ga0123355_10001030 3300009826 Bacteria 38630
208 Ga0123355_10186206 3300009826 Unclassified 3069
209 Ga0123355_10201572 3300009826 Bacteria 2905
210 Ga0123355_10210501 3300009826 Bacteria 2819
211 Ga0123355_10216444 3300009826 Bacteria 2764
212 Ga0123355_10476724 3300009826 Bacteria 1555
213 Ga0123356_10464763 3300010049 Bacteria 1416
214 Ga0123353_10287094 3300010167 Bacteria 2522
215 Ga0466731_229705 3300042622 Unclassified 1394
216 Ga0466704_005432 3300042643 Bacteria 1408
217 Ga0466704_562831 3300042643 Bacteria 2440
218 Ga0466724_36372 3300042649 Bacteria 3322
219 Ga0466724_65186 3300042649 Bacteria 1460
220 Ga0415639_004191 3300038395 Bacteria 37294
221 Ga0466693_126331 3300042592 Bacteria 1354
222 Ga0466706_251547 3300042599 Bacteria 84388
223 Ga0466707_408529 3300042601 Bacteria 5410
224 Ga0466713_094626 3300042602 Bacteria 5782
225 Ga0466714_071834 3300042603 Bacteria 2041
226 Ga0466714_077117 3300042603 Bacteria 6747
227 Ga0466714_134158 3300042603 Bacteria 2615
228 Ga0466722_107443 3300042609 Bacteria 1676
229 Ga0466698_026641 3300042610 Bacteria 1263
230 2227386345 2225789004 Bacteria 27406
231 2227477397 2225789004 Bacteria 22581
232 IMNBL1DRAFT_c0003667 3300000062 Bacteria 9684
233 JGI24702J35022_10099322 3300002462 Bacteria 1592
234 JGI24702J35022_10323320 3300002462 Bacteria 916
235 JGI24697J35500_11274903 3300002507 Bacteria 12544
236 Ga0072941_1001152 3300005201 Bacteria 56124
237 Ga0072941_1005122 3300005201 Bacteria 10650
238 Ga0466715_387240 3300042616 Bacteria 1977
239 Ga0466726_211281 3300042619 Bacteria 2244

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 30 208 0.96

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.