Protein Family IF06912
Metagenome
Isolate
158
Members
48
Samples
149
Scaffolds
322.96
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_249109|Ga0466722_249109_119_1237
- Length
- 372 aa
- Sequence
- LQNGAGLCNVIIIEGTSKNWLFSEVPWQFFALRSARHAFLGMPWKQNTGASMHEVLTELGKIGIVPVIKIDDVEKAVPLALALAAGGIPCAEVTFRTAQGEEAIRRIAKDVPGVLLGAGTVLTTEQVDRAIAAGARFIVSPGLNPKVAAYCVQKGIPVTPGCANPSDIEQALELGLEVVKFFPAEQAGGLDYIKAIAAPYPNLRFMPTGGISAANIAKYIGFEKILACGGSWMAGADLINSGDFKKITALANEAVMSLLGLHVAHIGINAGGEGLAQKAAAHFCSLFGFTARDGASSIFAGDSIEVVKQSAPGTHGHIAIGTNSLTRAVAYFERGGLSFDHAGAKKDASGKVMAVYFTEAILGFAIHLVQKK
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.3%
Kalotermitidae
21.7%
Unclassified
19.6%
Rhinotermitidae
8.7%
Termopsidae
6.5%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 15 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 18 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 40 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 41 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 44 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466723_189918 | 3300042618 | Bacteria | 3545 |
| 2 | Ga0466720_177838 | 3300042607 | Bacteria | 6284 |
| 3 | Ga0466720_182014 | 3300042607 | Bacteria | 2972 |
| 4 | Ga0466722_145100 | 3300042609 | Bacteria | 4226 |
| 5 | Ga0466691_182931 | 3300042593 | Bacteria | 1458 |
| 6 | Ga0466704_134440 | 3300042643 | Bacteria | 13173 |
| 7 | Ga0466704_312403 | 3300042643 | Bacteria | 12291 |
| 8 | Ga0466704_564140 | 3300042643 | Unclassified | 1489 |
| 9 | JGI24698J34947_10001205 | 3300002449 | Bacteria | 13520 |
| 10 | JGI24698J34947_10001338 | 3300002449 | Bacteria | 12963 |
| 11 | JGI24698J34947_10004420 | 3300002449 | Unclassified | 7651 |
| 12 | JGI24698J34947_10013851 | 3300002449 | Bacteria | 4396 |
| 13 | Ga0072941_1006872 | 3300005201 | Bacteria | 17040 |
| 14 | Ga0466705_235478 | 3300042612 | Bacteria | 1361 |
| 15 | Ga0466733_111851 | 3300042659 | Bacteria | 82439 |
| 16 | Ga0123356_10217464 | 3300010049 | Bacteria | 1965 |
| 17 | Ga0123356_10388033 | 3300010049 | Bacteria | 1531 |
| 18 | Ga0123353_10138308 | 3300010167 | Bacteria | 3904 |
| 19 | Ga0466712_013036 | 3300042614 | Bacteria | 41630 |
| 20 | Ga0466712_083934 | 3300042614 | Bacteria | 6894 |
| 21 | Ga0466712_132063 | 3300042614 | Unclassified | 2914 |
| 22 | Ga0466712_226104 | 3300042614 | Bacteria | 1299 |
| 23 | Ga0466711_323438 | 3300042615 | Bacteria | 1621 |
| 24 | Ga0466715_029667 | 3300042616 | Bacteria | 2898 |
| 25 | Ga0466718_076483 | 3300042617 | Bacteria | 7568 |
| 26 | Ga0466723_172960 | 3300042618 | Bacteria | 2684 |
| 27 | Ga0466726_445585 | 3300042619 | Bacteria | 2325 |
| 28 | Ga0466700_304802 | 3300042600 | Bacteria | 1930 |
| 29 | Ga0466722_058547 | 3300042609 | Bacteria | 2365 |
| 30 | Ga0466722_061628 | 3300042609 | Bacteria | 14264 |
| 31 | Ga0466722_098966 | 3300042609 | Bacteria | 13569 |
| 32 | Ga0466690_278447 | 3300042590 | Unclassified | 10374 |
| 33 | Ga0466694_297044 | 3300042594 | Bacteria | 1983 |
| 34 | Ga0466699_440334 | 3300042597 | Bacteria | 8698 |
| 35 | Ga0466729_293283 | 3300042621 | Bacteria | 2972 |
| 36 | Ga0466727_162996 | 3300042655 | Bacteria | 3308 |
| 37 | Ga0466727_165780 | 3300042655 | Bacteria | 4586 |
| 38 | JGI24698J34947_10000312 | 3300002449 | Bacteria | 21348 |
| 39 | JGI24698J34947_10005948 | 3300002449 | Bacteria | 6695 |
| 40 | JGI24698J34947_10011271 | 3300002449 | Bacteria | 4908 |
| 41 | Ga0072941_1045837 | 3300005201 | Bacteria | 5589 |
| 42 | Ga0072941_1191342 | 3300005201 | Bacteria | 1332 |
| 43 | Ga0466705_228135 | 3300042612 | Bacteria | 2736 |
| 44 | Ga0466712_021339 | 3300042614 | Bacteria | 10259 |
| 45 | Ga0466712_313318 | 3300042614 | Bacteria | 28274 |
| 46 | Ga0466711_216037 | 3300042615 | Bacteria | 3008 |
| 47 | Ga0466715_011397 | 3300042616 | Bacteria | 7617 |
| 48 | Ga0466715_465601 | 3300042616 | Bacteria | 4829 |
| 49 | Ga0466726_083175 | 3300042619 | Bacteria | 2481 |
| 50 | Ga0466706_167513 | 3300042599 | Bacteria | 3751 |
| 51 | Ga0466720_077601 | 3300042607 | Bacteria | 27407 |
| 52 | Ga0466722_078639 | 3300042609 | Bacteria | 8990 |
| 53 | Ga0466722_148518 | 3300042609 | Bacteria | 1968 |
| 54 | Ga0466722_153642 | 3300042609 | Bacteria | 9464 |
| 55 | Ga0466735_021647 | 3300042624 | Bacteria | 2949 |
| 56 | Ga0466735_040660 | 3300042624 | Bacteria | 16748 |
| 57 | Ga0466704_140776 | 3300042643 | Bacteria | 46136 |
| 58 | Ga0466704_256078 | 3300042643 | Bacteria | 10591 |
| 59 | JGI24698J34947_10007086 | 3300002449 | Bacteria | 6160 |
| 60 | JGI24698J34947_10016263 | 3300002449 | Bacteria | 4039 |
| 61 | JGI24698J34947_10103287 | 3300002449 | Bacteria | 1276 |
| 62 | JGI24695J34938_10021207 | 3300002450 | Bacteria | 3184 |
| 63 | JGI24702J35022_10004450 | 3300002462 | Bacteria | 8320 |
| 64 | Ga0466732_296135 | 3300042656 | Bacteria | 3571 |
| 65 | Ga0466733_134998 | 3300042659 | Bacteria | 6374 |
| 66 | Ga0466712_024498 | 3300042614 | Bacteria | 7580 |
| 67 | Ga0466715_201160 | 3300042616 | Bacteria | 1400 |
| 68 | Ga0466718_061997 | 3300042617 | Bacteria | 1144 |
| 69 | Ga0466723_239791 | 3300042618 | Bacteria | 36288 |
| 70 | Ga0466726_162794 | 3300042619 | Bacteria | 2934 |
| 71 | Ga0466726_191954 | 3300042619 | Bacteria | 2470 |
| 72 | Ga0466726_336713 | 3300042619 | Bacteria | 1687 |
| 73 | Ga0466720_020071 | 3300042607 | Bacteria | 4456 |
| 74 | Ga0466720_038270 | 3300042607 | Bacteria | 1353 |
| 75 | Ga0466720_051334 | 3300042607 | Bacteria | 27470 |
| 76 | Ga0466720_170228 | 3300042607 | Bacteria | 2659 |
| 77 | Ga0466722_029574 | 3300042609 | Bacteria | 17025 |
| 78 | Ga0466691_222900 | 3300042593 | Bacteria | 9677 |
| 79 | Ga0466696_383085 | 3300042596 | Bacteria | 5911 |
| 80 | Ga0466699_217538 | 3300042597 | Bacteria | 3700 |
| 81 | Ga0466735_173841 | 3300042624 | Bacteria | 1639 |
| 82 | JGI24698J34947_10003423 | 3300002449 | Bacteria | 8610 |
| 83 | JGI24698J34947_10021027 | 3300002449 | Bacteria | 3513 |
| 84 | Ga0072941_1045835 | 3300005201 | Bacteria | 2338 |
| 85 | Ga0466705_195432 | 3300042612 | Bacteria | 12968 |
| 86 | Ga0466733_150891 | 3300042659 | Bacteria | 9991 |
| 87 | Ga0123356_10000525 | 3300010049 | Bacteria | 42550 |
| 88 | Ga0123353_10294631 | 3300010167 | Bacteria | 2481 |
| 89 | Ga0466715_184975 | 3300042616 | Bacteria | 35546 |
| 90 | Ga0466719_246990 | 3300042606 | Bacteria | 1485 |
| 91 | Ga0466720_028744 | 3300042607 | Bacteria | 27506 |
| 92 | Ga0466720_178493 | 3300042607 | Bacteria | 21130 |
| 93 | Ga0466720_211597 | 3300042607 | Bacteria | 2441 |
| 94 | Ga0466720_213314 | 3300042607 | Bacteria | 9245 |
| 95 | Ga0466692_058765 | 3300042591 | Bacteria | 30559 |
| 96 | Ga0466692_059924 | 3300042591 | Bacteria | 1635 |
| 97 | Ga0466692_205402 | 3300042591 | Bacteria | 1751 |
| 98 | Ga0466691_016824 | 3300042593 | Bacteria | 7679 |
| 99 | Ga0466694_227521 | 3300042594 | Bacteria | 8424 |
| 100 | Ga0466696_389292 | 3300042596 | Bacteria | 3217 |
| 101 | Ga0466703_274337 | 3300042636 | Bacteria | 1241 |
| 102 | Ga0466703_278021 | 3300042636 | Bacteria | 19324 |
| 103 | JGI24698J34947_10021574 | 3300002449 | Bacteria | 3461 |
| 104 | JGI24695J34938_10091392 | 3300002450 | Bacteria | 1248 |
| 105 | Ga0123356_10145042 | 3300010049 | Bacteria | 2348 |
| 106 | Ga0466712_014589 | 3300042614 | Bacteria | 14395 |
| 107 | Ga0466711_120390 | 3300042615 | Bacteria | 6878 |
| 108 | Ga0466726_299586 | 3300042619 | Bacteria | 28168 |
| 109 | Ga0466717_084053 | 3300042604 | Bacteria | 1215 |
| 110 | Ga0466720_012816 | 3300042607 | Bacteria | 2669 |
| 111 | Ga0466720_148307 | 3300042607 | Bacteria | 4847 |
| 112 | Ga0456237_0014722 | 3300041968 | Bacteria | 1113 |
| 113 | Ga0466692_148222 | 3300042591 | Bacteria | 2993 |
| 114 | Ga0466704_055884 | 3300042643 | Bacteria | 73215 |
| 115 | Ga0466704_320494 | 3300042643 | Bacteria | 2914 |
| 116 | Ga0072941_1009298 | 3300005201 | Bacteria | 4998 |
| 117 | Ga0466733_208167 | 3300042659 | Bacteria | 31218 |
| 118 | Ga0123355_10764882 | 3300009826 | Bacteria | 1088 |
| 119 | Ga0466712_050412 | 3300042614 | Bacteria | 3081 |
| 120 | Ga0466718_049332 | 3300042617 | Bacteria | 3278 |
| 121 | Ga0466726_235760 | 3300042619 | Bacteria | 1312 |
| 122 | Ga0466706_029878 | 3300042599 | Bacteria | 6551 |
| 123 | Ga0466720_011301 | 3300042607 | Bacteria | 3223 |
| 124 | Ga0466722_120257 | 3300042609 | Bacteria | 2080 |
| 125 | Ga0415639_067696 | 3300038395 | Bacteria | 9683 |
| 126 | Ga0466690_313418 | 3300042590 | Bacteria | 1157 |
| 127 | Ga0466691_031807 | 3300042593 | Bacteria | 6695 |
| 128 | Ga0466694_202390 | 3300042594 | Bacteria | 1316 |
| 129 | JGI24698J34947_10025216 | 3300002449 | Bacteria | 3167 |
| 130 | JGI24698J34947_10040766 | 3300002449 | Bacteria | 2396 |
| 131 | Ga0466732_216406 | 3300042656 | Bacteria | 13856 |
| 132 | Ga0466733_150492 | 3300042659 | Bacteria | 9712 |
| 133 | Ga0123357_10076319 | 3300009784 | Bacteria | 4426 |
| 134 | Ga0123357_10338531 | 3300009784 | Bacteria | 1458 |
| 135 | Ga0466712_045764 | 3300042614 | Bacteria | 5358 |
| 136 | Ga0466718_086776 | 3300042617 | Bacteria | 73105 |
| 137 | Ga0466718_125010 | 3300042617 | Bacteria | 1572 |
| 138 | Ga0466723_214399 | 3300042618 | Bacteria | 12504 |
| 139 | Ga0466714_031662 | 3300042603 | Bacteria | 3529 |
| 140 | Ga0466714_096658 | 3300042603 | Bacteria | 2946 |
| 141 | Ga0466722_249109 | 3300042609 | Bacteria | 3230 |
| 142 | Ga0264413_103591 | 3300024493 | Bacteria | 5262 |
| 143 | Ga0264413_117976 | 3300024493 | Bacteria | 12307 |
| 144 | Ga0466690_126858 | 3300042590 | Bacteria | 5005 |
| 145 | Ga0466692_204869 | 3300042591 | Bacteria | 12273 |
| 146 | Ga0466699_225124 | 3300042597 | Bacteria | 17495 |
| 147 | Ga0466729_229454 | 3300042621 | Bacteria | 2535 |
| 148 | Ga0466704_508010 | 3300042643 | Bacteria | 1815 |
| 149 | Ga0466725_263555 | 3300042654 | Unclassified | 8619 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01081 | Aldolase | KDPG and KHG aldolase | 60 | 250 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01081 | GO:0016829 | lyase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.