Protein Family IF06900
Metagenome
Isolate
139
Members
62
Samples
118
Scaffolds
170.96
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_232470|Ga0466722_232470_35008_35559
- Length
- 183 aa
- Sequence
- MKKEDKAKIIEQLSEVVKEYPNFYLTDIEALNAGKTSALRRECFKQGVKLMVVKNTLLKKVFENIEEDYSALNVALKGNTAIMLSHTTNVAARLIKEFTKASKDKKNIRPQLKAAYVQESFYVGADYLEALVNIKSKEELLGDIIALLQSPAKNIILALQSSGQTILGVLKTLEEDKVIVYSK
Sample Types
Isolate
15.1%
Metagenome
84.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.9%
Blattidae
26.2%
Kalotermitidae
21.3%
Unclassified
11.5%
Rhinotermitidae
4.9%
Passalidae
4.9%
Hodotermitidae
1.6%
Termopsidae
1.6%
Taxonomy
Archaea
0
Bacteria
137
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 4 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 5 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 15 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 16 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 17 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 38 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 39 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 43 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 44 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 45 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 46 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 47 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 48 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 49 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 50 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 55 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 56 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 61 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_082349 | 3300042656 | Bacteria | 5142 |
| 2 | Ga0466723_360028 | 3300042618 | Bacteria | 13095 |
| 3 | Ga0466728_306064 | 3300042620 | Bacteria | 1757 |
| 4 | Ga0466729_010781 | 3300042621 | Bacteria | 16724 |
| 5 | Ga0123356_10110251 | 3300010049 | Bacteria | 2657 |
| 6 | Ga0466706_036814 | 3300042599 | Bacteria | 5066 |
| 7 | Ga0466706_175840 | 3300042599 | Bacteria | 8687 |
| 8 | Ga0466716_514970 | 3300042605 | Bacteria | 14004 |
| 9 | Ga0466721_186390 | 3300042608 | Bacteria | 7274 |
| 10 | Ga0466697_039353 | 3300042611 | Bacteria | 6345 |
| 11 | 2227547988 | 2225789004 | Bacteria | 2891 |
| 12 | JGI24702J35022_10003774 | 3300002462 | Bacteria | 9104 |
| 13 | JGI24702J35022_10013322 | 3300002462 | Bacteria | 4556 |
| 14 | Ga0466735_001533 | 3300042624 | Bacteria | 10722 |
| 15 | Ga0466724_08735 | 3300042649 | Bacteria | 2383 |
| 16 | Ga0466697_105408 | 3300042611 | Bacteria | 2231 |
| 17 | Ga0466697_270836 | 3300042611 | Bacteria | 3358 |
| 18 | Ga0466733_185216 | 3300042659 | Bacteria | 77937 |
| 19 | Ga0466710_045644 | 3300042613 | Bacteria | 14150 |
| 20 | Ga0123356_11581992 | 3300010049 | Bacteria | 811 |
| 21 | Ga0466696_363698 | 3300042596 | Bacteria | 1024 |
| 22 | Ga0466706_036251 | 3300042599 | Bacteria | 1673 |
| 23 | Ga0466722_232470 | 3300042609 | Bacteria | 73289 |
| 24 | 2227480184 | 2225789004 | Bacteria | 78831 |
| 25 | 2227516308 | 2225789004 | Bacteria | 17630 |
| 26 | IMNBL1DRAFT_c0001329 | 3300000062 | Bacteria | 18611 |
| 27 | IMNBL1DRAFT_c0013585 | 3300000062 | Bacteria | 3642 |
| 28 | JGI24702J35022_10001523 | 3300002462 | Bacteria | 14396 |
| 29 | JGI24699J35502_11133854 | 3300002509 | Bacteria | 17140 |
| 30 | JGI24696J40584_12957527 | 3300002834 | Bacteria | 3561 |
| 31 | Ga0068305_10005158 | 3300005083 | Bacteria | 2384 |
| 32 | Ga0466703_060828 | 3300042636 | Bacteria | 8175 |
| 33 | Ga0466697_275291 | 3300042611 | Unclassified | 1038 |
| 34 | Ga0466733_068075 | 3300042659 | Bacteria | 14154 |
| 35 | Ga0466733_117626 | 3300042659 | Bacteria | 1997 |
| 36 | Ga0466733_158876 | 3300042659 | Bacteria | 3877 |
| 37 | Ga0123357_10396321 | 3300009784 | Bacteria | 1262 |
| 38 | Ga0123356_10633588 | 3300010049 | Unclassified | 1235 |
| 39 | Ga0123353_10218071 | 3300010167 | Bacteria | 2986 |
| 40 | Ga0123353_10252269 | 3300010167 | Bacteria | 2732 |
| 41 | Ga0466691_221380 | 3300042593 | Bacteria | 15148 |
| 42 | Ga0466696_394022 | 3300042596 | Bacteria | 212291 |
| 43 | Ga0466706_019580 | 3300042599 | Bacteria | 3095 |
| 44 | Ga0466706_183342 | 3300042599 | Bacteria | 5616 |
| 45 | Ga0466716_166359 | 3300042605 | Bacteria | 5403 |
| 46 | Ga0466722_216312 | 3300042609 | Bacteria | 6465 |
| 47 | IMNBL1DRAFT_c0003160 | 3300000062 | Bacteria | 10827 |
| 48 | IMNBL1DRAFT_c0006011 | 3300000062 | Bacteria | 6766 |
| 49 | Ga0466735_019509 | 3300042624 | Bacteria | 1396 |
| 50 | Ga0466703_344027 | 3300042636 | Bacteria | 12646 |
| 51 | Ga0466703_394273 | 3300042636 | Bacteria | 22669 |
| 52 | Ga0466724_07812 | 3300042649 | Bacteria | 1560 |
| 53 | Ga0466725_080611 | 3300042654 | Bacteria | 3004 |
| 54 | Ga0466705_273715 | 3300042612 | Bacteria | 53499 |
| 55 | Ga0123356_10881042 | 3300010049 | Bacteria | 1066 |
| 56 | Ga0123356_10982266 | 3300010049 | Bacteria | 1015 |
| 57 | Ga0415639_275667 | 3300038395 | Bacteria | 1443 |
| 58 | Ga0466690_227552 | 3300042590 | Bacteria | 11759 |
| 59 | Ga0466690_256751 | 3300042590 | Bacteria | 42016 |
| 60 | Ga0466714_162927 | 3300042603 | Bacteria | 1975 |
| 61 | Ga0466716_456732 | 3300042605 | Bacteria | 12328 |
| 62 | 2227452194 | 2225789004 | Bacteria | 1012 |
| 63 | Ga0466732_112622 | 3300042656 | Bacteria | 2032 |
| 64 | Ga0466711_035701 | 3300042615 | Bacteria | 9190 |
| 65 | Ga0466715_257341 | 3300042616 | Bacteria | 23626 |
| 66 | Ga0123353_10002158 | 3300010167 | Bacteria | 24325 |
| 67 | Ga0466657_134140 | 3300042582 | Bacteria | 4288 |
| 68 | Ga0466657_242066 | 3300042582 | Bacteria | 3290 |
| 69 | Ga0466696_020992 | 3300042596 | Bacteria | 1025 |
| 70 | Ga0466706_033947 | 3300042599 | Bacteria | 3035 |
| 71 | Ga0466714_020760 | 3300042603 | Bacteria | 14729 |
| 72 | Ga0466714_025369 | 3300042603 | Bacteria | 1117 |
| 73 | Ga0466714_151868 | 3300042603 | Bacteria | 1192 |
| 74 | IMNBL1DRAFT_c0044120 | 3300000062 | Bacteria | 1468 |
| 75 | Ga0466735_147550 | 3300042624 | Bacteria | 1226 |
| 76 | Ga0466708_435851 | 3300042652 | Bacteria | 53327 |
| 77 | Ga0466711_140047 | 3300042615 | Bacteria | 6511 |
| 78 | Ga0466711_413274 | 3300042615 | Bacteria | 6092 |
| 79 | Ga0466723_139489 | 3300042618 | Bacteria | 11970 |
| 80 | Ga0123357_10006569 | 3300009784 | Bacteria | 14225 |
| 81 | Ga0466690_407298 | 3300042590 | Bacteria | 9434 |
| 82 | Ga0466696_205463 | 3300042596 | Bacteria | 14851 |
| 83 | Ga0466696_258694 | 3300042596 | Bacteria | 2903 |
| 84 | Ga0466707_256860 | 3300042601 | Bacteria | 2543 |
| 85 | Ga0466714_002012 | 3300042603 | Bacteria | 2083 |
| 86 | Ga0466714_059729 | 3300042603 | Bacteria | 25353 |
| 87 | 2227035910 | 2225789003 | Bacteria | 20847 |
| 88 | 2227513528 | 2225789004 | Bacteria | 18058 |
| 89 | IMNBL1DRAFT_c0002427 | 3300000062 | Bacteria | 12971 |
| 90 | IMNBL1DRAFT_c0009148 | 3300000062 | Bacteria | 4938 |
| 91 | JGI24702J35022_10017399 | 3300002462 | Bacteria | 3928 |
| 92 | JGI24705J35276_12234556 | 3300002504 | Bacteria | 5628 |
| 93 | Ga0466703_348168 | 3300042636 | Bacteria | 8397 |
| 94 | Ga0466704_048987 | 3300042643 | Bacteria | 1659 |
| 95 | Ga0466709_086078 | 3300042648 | Bacteria | 4530 |
| 96 | Ga0466715_123796 | 3300042616 | Bacteria | 41840 |
| 97 | Ga0466715_165538 | 3300042616 | Bacteria | 16153 |
| 98 | Ga0466728_093817 | 3300042620 | Bacteria | 21218 |
| 99 | Ga0265387_1068802 | 3300024582 | Bacteria | 677 |
| 100 | Ga0466714_016336 | 3300042603 | Bacteria | 3156 |
| 101 | Ga0466716_201587 | 3300042605 | Bacteria | 2415 |
| 102 | Ga0466722_015704 | 3300042609 | Bacteria | 71312 |
| 103 | Ga0466722_144286 | 3300042609 | Bacteria | 1129 |
| 104 | Ga0466735_053633 | 3300042624 | Bacteria | 1790 |
| 105 | Ga0466703_378604 | 3300042636 | Bacteria | 14079 |
| 106 | Ga0466733_122875 | 3300042659 | Bacteria | 7035 |
| 107 | Ga0466710_266877 | 3300042613 | Bacteria | 7625 |
| 108 | Ga0466711_093162 | 3300042615 | Bacteria | 19638 |
| 109 | Ga0466711_194622 | 3300042615 | Bacteria | 2367 |
| 110 | Ga0466715_299034 | 3300042616 | Bacteria | 37987 |
| 111 | Ga0466690_241545 | 3300042590 | Bacteria | 13899 |
| 112 | Ga0466691_076024 | 3300042593 | Bacteria | 14619 |
| 113 | Ga0466691_189088 | 3300042593 | Bacteria | 1048 |
| 114 | Ga0466713_028689 | 3300042602 | Bacteria | 1844 |
| 115 | IMNBL1DRAFT_c0000530 | 3300000062 | Bacteria | 31244 |
| 116 | JGI24702J35022_10061098 | 3300002462 | Bacteria | 2015 |
| 117 | JGI24702J35022_10328474 | 3300002462 | Bacteria | 909 |
| 118 | Ga0466709_117347 | 3300042648 | Bacteria | 10931 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00466 | Ribosomal_L10 | Ribosomal protein L10 | 1 | 100 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.