Protein Family IF06874
Metagenome
Isolate
181
Members
57
Samples
175
Scaffolds
180.02
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_195473|Ga0466722_195473_5725_6291
- Length
- 188 aa
- Sequence
- MAERQAKFYVLRAVSGKENKVREYIEAEMKNSDLGDHVLQVLIPTEKTFTVRNGKKVMKERAYLPGYVLVEADLVGEVVHRLRNIPNVIGFLGVKDTRDGAKDNQPVPLRPSEVARVLGTVDELQEQEEEMDVRFYTGETVKVTYGPFNGFDGTIEEVNTEKKKLKVMVKIFGRKTPIELSYVQVEKE
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.4%
Kalotermitidae
24.6%
Blattidae
8.8%
Unclassified
7.0%
Termopsidae
7.0%
Rhinotermitidae
5.3%
Passalidae
5.3%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
167
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 24 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 25 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 26 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 35 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 36 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 37 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 38 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 39 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 40 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 41 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 42 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 43 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 44 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 45 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 47 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 48 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_106782 | 3300042612 | Bacteria | 11995 |
| 2 | Ga0466713_058214 | 3300042602 | Bacteria | 26989 |
| 3 | Ga0466722_148707 | 3300042609 | Bacteria | 7298 |
| 4 | Ga0466722_195473 | 3300042609 | Bacteria | 14303 |
| 5 | Ga0466698_056649 | 3300042610 | Bacteria | 2816 |
| 6 | Ga0466704_256165 | 3300042643 | Unclassified | 2707 |
| 7 | Ga0466727_191168 | 3300042655 | Bacteria | 2023 |
| 8 | Ga0466692_047378 | 3300042591 | Bacteria | 93081 |
| 9 | Ga0466694_384618 | 3300042594 | Bacteria | 1382 |
| 10 | Ga0466696_131555 | 3300042596 | Bacteria | 5983 |
| 11 | Ga0466710_142051 | 3300042613 | Bacteria | 1894 |
| 12 | Ga0466710_371909 | 3300042613 | Bacteria | 1328 |
| 13 | Ga0466728_202737 | 3300042620 | Bacteria | 14768 |
| 14 | Ga0466729_010781 | 3300042621 | Bacteria | 16724 |
| 15 | JGI24702J35022_10013322 | 3300002462 | Bacteria | 4556 |
| 16 | Ga0123353_10320117 | 3300010167 | Bacteria | 2354 |
| 17 | Ga0466713_005670 | 3300042602 | Bacteria | 17868 |
| 18 | Ga0466719_040334 | 3300042606 | Bacteria | 9091 |
| 19 | Ga0466698_032639 | 3300042610 | Bacteria | 2032 |
| 20 | Ga0466731_306348 | 3300042622 | Bacteria | 1220 |
| 21 | Ga0466709_179015 | 3300042648 | Bacteria | 32482 |
| 22 | Ga0466708_435851 | 3300042652 | Bacteria | 53327 |
| 23 | Ga0466657_242066 | 3300042582 | Bacteria | 3290 |
| 24 | Ga0466690_016395 | 3300042590 | Unclassified | 1479 |
| 25 | Ga0466690_092689 | 3300042590 | Bacteria | 81043 |
| 26 | Ga0466693_367804 | 3300042592 | Unclassified | 1027 |
| 27 | Ga0466691_155305 | 3300042593 | Bacteria | 5444 |
| 28 | Ga0466695_313501 | 3300042595 | Bacteria | 1219 |
| 29 | Ga0466715_257341 | 3300042616 | Bacteria | 23626 |
| 30 | Ga0466723_118143 | 3300042618 | Bacteria | 49080 |
| 31 | 2227529906 | 2225789004 | Bacteria | 3170 |
| 32 | Ga0068305_10342568 | 3300005083 | Unclassified | 1520 |
| 33 | Ga0466733_146149 | 3300042659 | Bacteria | 8985 |
| 34 | Ga0466700_345407 | 3300042600 | Bacteria | 1595 |
| 35 | Ga0466713_041439 | 3300042602 | Bacteria | 39210 |
| 36 | Ga0466713_047328 | 3300042602 | Bacteria | 1761 |
| 37 | Ga0466713_135469 | 3300042602 | Bacteria | 58117 |
| 38 | Ga0466716_118364 | 3300042605 | Bacteria | 14527 |
| 39 | Ga0466719_226421 | 3300042606 | Unclassified | 2961 |
| 40 | Ga0466722_215146 | 3300042609 | Bacteria | 10662 |
| 41 | Ga0466703_394273 | 3300042636 | Bacteria | 22669 |
| 42 | Ga0466704_020547 | 3300042643 | Unclassified | 1268 |
| 43 | Ga0466704_380863 | 3300042643 | Bacteria | 21447 |
| 44 | Ga0466727_242249 | 3300042655 | Bacteria | 19089 |
| 45 | Ga0466727_249957 | 3300042655 | Bacteria | 36639 |
| 46 | Ga0466691_157960 | 3300042593 | Bacteria | 19718 |
| 47 | Ga0466696_394022 | 3300042596 | Bacteria | 212291 |
| 48 | Ga0466711_182646 | 3300042615 | Bacteria | 12320 |
| 49 | Ga0466711_198310 | 3300042615 | Bacteria | 16707 |
| 50 | Ga0466715_077069 | 3300042616 | Bacteria | 2855 |
| 51 | Ga0466715_185354 | 3300042616 | Bacteria | 6442 |
| 52 | Ga0466723_307718 | 3300042618 | Bacteria | 90883 |
| 53 | Ga0466726_290125 | 3300042619 | Bacteria | 7644 |
| 54 | IMNBL1DRAFT_c0003160 | 3300000062 | Bacteria | 10827 |
| 55 | Ga0123356_11190125 | 3300010049 | Bacteria | 928 |
| 56 | Ga0466707_388330 | 3300042601 | Bacteria | 11315 |
| 57 | Ga0466731_134541 | 3300042622 | Bacteria | 1007 |
| 58 | Ga0466735_208518 | 3300042624 | Bacteria | 6138 |
| 59 | Ga0466703_320533 | 3300042636 | Bacteria | 31058 |
| 60 | Ga0466704_226601 | 3300042643 | Bacteria | 45308 |
| 61 | Ga0466704_409278 | 3300042643 | Unclassified | 1704 |
| 62 | Ga0466708_013558 | 3300042652 | Bacteria | 23219 |
| 63 | Ga0466727_305684 | 3300042655 | Bacteria | 3825 |
| 64 | Ga0466690_407298 | 3300042590 | Bacteria | 9434 |
| 65 | Ga0466693_366944 | 3300042592 | Bacteria | 1436 |
| 66 | Ga0466694_307155 | 3300042594 | Unclassified | 1291 |
| 67 | Ga0466696_205463 | 3300042596 | Bacteria | 14851 |
| 68 | Ga0466711_125896 | 3300042615 | Bacteria | 8224 |
| 69 | Ga0466711_140047 | 3300042615 | Bacteria | 6511 |
| 70 | Ga0466715_169547 | 3300042616 | Bacteria | 17957 |
| 71 | Ga0466715_302955 | 3300042616 | Bacteria | 14273 |
| 72 | Ga0466715_446053 | 3300042616 | Bacteria | 21540 |
| 73 | Ga0466726_291963 | 3300042619 | Bacteria | 1866 |
| 74 | Ga0466728_172522 | 3300042620 | Bacteria | 21138 |
| 75 | 2227035910 | 2225789003 | Bacteria | 20847 |
| 76 | IMNBL1DRAFT_c0002427 | 3300000062 | Bacteria | 12971 |
| 77 | JGI24698J34947_10007360 | 3300002449 | Bacteria | 6053 |
| 78 | JGI24702J35022_10141245 | 3300002462 | Bacteria | 1344 |
| 79 | JGI24705J35276_12222374 | 3300002504 | Bacteria | 2416 |
| 80 | Ga0068302_10125739 | 3300005071 | Bacteria | 1936 |
| 81 | Ga0068305_10001980 | 3300005083 | Bacteria | 22123 |
| 82 | Ga0068305_10010489 | 3300005083 | Bacteria | 8679 |
| 83 | Ga0068305_10112966 | 3300005083 | Bacteria | 1859 |
| 84 | Ga0072940_1312627 | 3300005200 | Bacteria | 1388 |
| 85 | Ga0466697_114936 | 3300042611 | Bacteria | 1532 |
| 86 | Ga0466697_133731 | 3300042611 | Bacteria | 1753 |
| 87 | Ga0466705_246551 | 3300042612 | Bacteria | 20411 |
| 88 | Ga0466713_044001 | 3300042602 | Bacteria | 42258 |
| 89 | Ga0466713_056227 | 3300042602 | Unclassified | 2092 |
| 90 | Ga0466716_058478 | 3300042605 | Bacteria | 30197 |
| 91 | Ga0466716_163313 | 3300042605 | Bacteria | 6326 |
| 92 | Ga0466703_281595 | 3300042636 | Bacteria | 16908 |
| 93 | Ga0466709_117007 | 3300042648 | Unclassified | 3887 |
| 94 | Ga0466727_131064 | 3300042655 | Bacteria | 28730 |
| 95 | Ga0466727_307077 | 3300042655 | Bacteria | 3818 |
| 96 | Ga0466690_256751 | 3300042590 | Bacteria | 42016 |
| 97 | Ga0466692_172495 | 3300042591 | Bacteria | 15440 |
| 98 | Ga0466691_102040 | 3300042593 | Bacteria | 39028 |
| 99 | Ga0466696_429379 | 3300042596 | Bacteria | 1220 |
| 100 | Ga0466715_187003 | 3300042616 | Bacteria | 2578 |
| 101 | Ga0466718_009529 | 3300042617 | Bacteria | 1933 |
| 102 | Ga0466723_254775 | 3300042618 | Unclassified | 1063 |
| 103 | Ga0466729_072533 | 3300042621 | Bacteria | 11377 |
| 104 | 2227426932 | 2225789004 | Bacteria | 1040 |
| 105 | JGI24702J35022_10002246 | 3300002462 | Bacteria | 11872 |
| 106 | JGI24702J35022_10299616 | 3300002462 | Bacteria | 948 |
| 107 | Ga0068302_10046659 | 3300005071 | Bacteria | 1817 |
| 108 | Ga0466697_270836 | 3300042611 | Bacteria | 3358 |
| 109 | Ga0466705_091456 | 3300042612 | Bacteria | 20257 |
| 110 | Ga0466705_278201 | 3300042612 | Bacteria | 13432 |
| 111 | Ga0466707_015416 | 3300042601 | Bacteria | 12912 |
| 112 | Ga0466707_358841 | 3300042601 | Bacteria | 13443 |
| 113 | Ga0466713_009753 | 3300042602 | Bacteria | 19425 |
| 114 | Ga0466713_032013 | 3300042602 | Bacteria | 64924 |
| 115 | Ga0466717_116989 | 3300042604 | Bacteria | 1978 |
| 116 | Ga0466719_076192 | 3300042606 | Bacteria | 17216 |
| 117 | Ga0466719_084719 | 3300042606 | Bacteria | 20043 |
| 118 | Ga0466735_119142 | 3300042624 | Unclassified | 1196 |
| 119 | Ga0466704_258054 | 3300042643 | Bacteria | 19952 |
| 120 | Ga0466725_378000 | 3300042654 | Bacteria | 1239 |
| 121 | Ga0466656_204708 | 3300042550 | Bacteria | 13840 |
| 122 | Ga0466690_384953 | 3300042590 | Bacteria | 5227 |
| 123 | Ga0466696_029934 | 3300042596 | Bacteria | 1847 |
| 124 | Ga0466711_035602 | 3300042615 | Bacteria | 27116 |
| 125 | Ga0466718_046598 | 3300042617 | Bacteria | 2056 |
| 126 | Ga0466723_281374 | 3300042618 | Bacteria | 18481 |
| 127 | 2227297451 | 2225789004 | Bacteria | 6645 |
| 128 | IMNBL1DRAFT_c0001329 | 3300000062 | Bacteria | 18611 |
| 129 | IMNBL1DRAFT_c0069950 | 3300000062 | Bacteria | 1017 |
| 130 | JGI24702J35022_10001523 | 3300002462 | Bacteria | 14396 |
| 131 | JGI24702J35022_10003759 | 3300002462 | Bacteria | 9121 |
| 132 | JGI24702J35022_10010998 | 3300002462 | Bacteria | 5047 |
| 133 | JGI24699J35502_11133854 | 3300002509 | Bacteria | 17140 |
| 134 | Ga0068305_10011238 | 3300005083 | Bacteria | 1893 |
| 135 | Ga0068305_10025899 | 3300005083 | Bacteria | 21025 |
| 136 | Ga0466705_327310 | 3300042612 | Bacteria | 4205 |
| 137 | Ga0466733_010750 | 3300042659 | Bacteria | 35772 |
| 138 | Ga0466706_145688 | 3300042599 | Bacteria | 20534 |
| 139 | Ga0466714_079129 | 3300042603 | Bacteria | 4453 |
| 140 | Ga0466719_129534 | 3300042606 | Bacteria | 13143 |
| 141 | Ga0466719_273011 | 3300042606 | Bacteria | 1733 |
| 142 | Ga0466731_280324 | 3300042622 | Bacteria | 1505 |
| 143 | Ga0466735_072871 | 3300042624 | Bacteria | 6769 |
| 144 | Ga0466703_173046 | 3300042636 | Bacteria | 32889 |
| 145 | Ga0466704_076372 | 3300042643 | Bacteria | 18331 |
| 146 | Ga0466709_110644 | 3300042648 | Bacteria | 26395 |
| 147 | Ga0466709_117347 | 3300042648 | Bacteria | 10931 |
| 148 | Ga0466690_021422 | 3300042590 | Bacteria | 41181 |
| 149 | Ga0466693_432662 | 3300042592 | Bacteria | 3597 |
| 150 | Ga0466694_133825 | 3300042594 | Unclassified | 1029 |
| 151 | Ga0466715_299034 | 3300042616 | Bacteria | 37987 |
| 152 | Ga0466726_336827 | 3300042619 | Bacteria | 13204 |
| 153 | Ga0466726_404423 | 3300042619 | Bacteria | 1845 |
| 154 | IMNBL1DRAFT_c0000530 | 3300000062 | Bacteria | 31244 |
| 155 | Ga0068302_10201357 | 3300005071 | Bacteria | 748 |
| 156 | Ga0466733_032449 | 3300042659 | Bacteria | 75954 |
| 157 | Ga0466722_015704 | 3300042609 | Bacteria | 71312 |
| 158 | Ga0466722_061307 | 3300042609 | Bacteria | 5586 |
| 159 | Ga0466703_102327 | 3300042636 | Bacteria | 38440 |
| 160 | Ga0466709_014514 | 3300042648 | Bacteria | 492815 |
| 161 | Ga0466708_228295 | 3300042652 | Bacteria | 20202 |
| 162 | Ga0466725_035410 | 3300042654 | Bacteria | 15741 |
| 163 | Ga0466727_194661 | 3300042655 | Bacteria | 11133 |
| 164 | Ga0466690_050653 | 3300042590 | Bacteria | 29405 |
| 165 | Ga0466699_008495 | 3300042597 | Bacteria | 2196 |
| 166 | Ga0466711_017007 | 3300042615 | Bacteria | 3131 |
| 167 | Ga0466715_123796 | 3300042616 | Bacteria | 41840 |
| 168 | Ga0466726_071920 | 3300042619 | Bacteria | 12800 |
| 169 | Ga0466726_331043 | 3300042619 | Bacteria | 1414 |
| 170 | Ga0466728_093817 | 3300042620 | Bacteria | 21218 |
| 171 | Ga0466728_294380 | 3300042620 | Bacteria | 1500 |
| 172 | 2227476549 | 2225789004 | Bacteria | 881 |
| 173 | IMNBL1DRAFT_c0011347 | 3300000062 | Bacteria | 4170 |
| 174 | JGI24698J34947_10083571 | 3300002449 | Bacteria | 1489 |
| 175 | JGI24702J35022_10080012 | 3300002462 | Unclassified | 1769 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.