Protein Family IF06872
Metagenome
Isolate
273
Members
69
Samples
247
Scaffolds
492.38
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_192706|Ga0466722_192706_227_1828
- Length
- 533 aa
- Sequence
- MKILMATSEAVPFAKTGGLADAVSALSLALAKLGHEVKIVLPRYYAISKEKLTLLKGELGVPVGGFEEWCAVYKTTLPGSDVKNPIETYFIDHEIFFGRDGVYGTPFEPDFIDNPRRFTFLSRAVFQLCHKINWFPNVLHSHDWPTALVPVYLKYALRNGPFEKTVSILTIHNLGYQGVYHKDNFHYTGLGWNVYYEGGFEDWNMMNMLKAGIYSADRLNTVSETYCAETMMQEHGFRLDGPLRYRNADYRGILNGVDTDVWNPAKDNYIPKQYSVDDLSGKAAAKAELQKSFGLQINPDVPVIGMITRLTGQKGVGEVFGPGYGSAFSMCRDMKLDFIVLGSGEAWCEHELRGLSSRLSNFRAIIGYSESISHLIEAGSDFFLMPSRYEPCGLNQMYSLLYGTPPIVRRTGGLVDTVTNFNEETGEGTGFMFDDLTPHAVYNTVGWALWAYYNRPKEIAAMRKRGMKQDFSWAYSAKKYLDMYNDAGAKEGSAAPRKQIKAAQPETSKITTKQASPPESSAKPSTRRQKGRN
Sample Types
Isolate
9.5%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.0%
Unclassified
23.5%
Kalotermitidae
20.6%
Blattidae
17.6%
Rhinotermitidae
5.9%
Termopsidae
4.4%
Hodotermitidae
1.5%
Blaberidae
1.5%
Taxonomy
Archaea
0
Bacteria
264
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 10 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 11 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 12 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 23 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 24 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 27 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 28 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 29 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 30 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 40 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 41 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 42 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 48 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 49 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 54 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 55 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 56 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 57 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 58 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 61 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 62 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 63 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 64 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 65 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 66 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 67 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 68 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 69 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_182624 | 3300042614 | Unclassified | 6105 |
| 2 | Ga0466723_197715 | 3300042618 | Bacteria | 5446 |
| 3 | Ga0466723_252410 | 3300042618 | Bacteria | 10433 |
| 4 | Ga0466723_373324 | 3300042618 | Bacteria | 3238 |
| 5 | Ga0466726_147691 | 3300042619 | Bacteria | 5672 |
| 6 | Ga0466726_296455 | 3300042619 | Bacteria | 8763 |
| 7 | Ga0466726_393607 | 3300042619 | Bacteria | 4022 |
| 8 | Ga0466726_420833 | 3300042619 | Bacteria | 12883 |
| 9 | Ga0466728_154978 | 3300042620 | Bacteria | 6842 |
| 10 | Ga0466690_272098 | 3300042590 | Bacteria | 3365 |
| 11 | Ga0466692_036946 | 3300042591 | Bacteria | 12173 |
| 12 | Ga0466694_299432 | 3300042594 | Bacteria | 2145 |
| 13 | Ga0466696_129920 | 3300042596 | Bacteria | 1749 |
| 14 | Ga0466696_326712 | 3300042596 | Bacteria | 3012 |
| 15 | AustNasuHG_c1010987 | 3300000089 | Bacteria | 3144 |
| 16 | JGI24698J34947_10023555 | 3300002449 | Bacteria | 3294 |
| 17 | Ga0466707_400100 | 3300042601 | Bacteria | 2051 |
| 18 | Ga0466713_067884 | 3300042602 | Bacteria | 5123 |
| 19 | Ga0466713_111904 | 3300042602 | Bacteria | 8567 |
| 20 | Ga0466713_116739 | 3300042602 | Bacteria | 5733 |
| 21 | Ga0466716_334663 | 3300042605 | Bacteria | 4119 |
| 22 | Ga0466719_183342 | 3300042606 | Bacteria | 8473 |
| 23 | Ga0466722_018875 | 3300042609 | Bacteria | 8508 |
| 24 | Ga0466722_061348 | 3300042609 | Bacteria | 28035 |
| 25 | Ga0466722_202576 | 3300042609 | Bacteria | 4726 |
| 26 | Ga0123353_10021424 | 3300010167 | Bacteria | 9702 |
| 27 | Ga0466703_210695 | 3300042636 | Bacteria | 9703 |
| 28 | Ga0466708_129221 | 3300042652 | Bacteria | 7987 |
| 29 | Ga0466705_130457 | 3300042612 | Bacteria | 10314 |
| 30 | Ga0466705_384884 | 3300042612 | Bacteria | 15970 |
| 31 | Ga0466732_088968 | 3300042656 | Bacteria | 1531 |
| 32 | Ga0466711_216294 | 3300042615 | Bacteria | 31475 |
| 33 | Ga0466715_107667 | 3300042616 | Bacteria | 9269 |
| 34 | Ga0466715_607961 | 3300042616 | Bacteria | 29717 |
| 35 | Ga0466715_636930 | 3300042616 | Bacteria | 4766 |
| 36 | Ga0466723_252265 | 3300042618 | Bacteria | 5498 |
| 37 | Ga0466726_023989 | 3300042619 | Bacteria | 18702 |
| 38 | Ga0466726_158472 | 3300042619 | Bacteria | 23168 |
| 39 | Ga0466728_217599 | 3300042620 | Bacteria | 7608 |
| 40 | Ga0466728_311555 | 3300042620 | Bacteria | 12156 |
| 41 | Ga0456237_0000878 | 3300041968 | Bacteria | 4729 |
| 42 | Ga0466692_041475 | 3300042591 | Bacteria | 25779 |
| 43 | Ga0466691_114031 | 3300042593 | Bacteria | 22683 |
| 44 | Ga0466691_141867 | 3300042593 | Bacteria | 30604 |
| 45 | Ga0466696_354784 | 3300042596 | Bacteria | 20829 |
| 46 | Ga0466699_203771 | 3300042597 | Bacteria | 13304 |
| 47 | JGI24698J34947_10000892 | 3300002449 | Bacteria | 15123 |
| 48 | Ga0466716_031431 | 3300042605 | Bacteria | 13180 |
| 49 | Ga0466722_064669 | 3300042609 | Bacteria | 3012 |
| 50 | Ga0466722_077472 | 3300042609 | Bacteria | 5674 |
| 51 | Ga0466722_087010 | 3300042609 | Bacteria | 5978 |
| 52 | Ga0123353_10027191 | 3300010167 | Bacteria | 8761 |
| 53 | Ga0123353_10089913 | 3300010167 | Bacteria | 4944 |
| 54 | Ga0123353_10344435 | 3300010167 | Bacteria | 2249 |
| 55 | Ga0466735_030963 | 3300042624 | Bacteria | 35120 |
| 56 | Ga0466735_097400 | 3300042624 | Bacteria | 4434 |
| 57 | Ga0466735_154174 | 3300042624 | Bacteria | 1777 |
| 58 | Ga0466703_089559 | 3300042636 | Bacteria | 7112 |
| 59 | Ga0466704_070305 | 3300042643 | Unclassified | 4500 |
| 60 | Ga0466704_366292 | 3300042643 | Bacteria | 3418 |
| 61 | Ga0466704_366373 | 3300042643 | Unclassified | 2926 |
| 62 | Ga0466709_119909 | 3300042648 | Bacteria | 10292 |
| 63 | Ga0466708_193150 | 3300042652 | Bacteria | 7087 |
| 64 | Ga0466708_318787 | 3300042652 | Bacteria | 39395 |
| 65 | Ga0466705_188973 | 3300042612 | Bacteria | 20855 |
| 66 | Ga0466712_221181 | 3300042614 | Bacteria | 28077 |
| 67 | Ga0466711_150627 | 3300042615 | Bacteria | 6903 |
| 68 | Ga0466715_076101 | 3300042616 | Bacteria | 2222 |
| 69 | Ga0466723_002210 | 3300042618 | Bacteria | 2920 |
| 70 | Ga0466723_008034 | 3300042618 | Bacteria | 11024 |
| 71 | Ga0466726_032630 | 3300042619 | Bacteria | 1690 |
| 72 | Ga0466726_176341 | 3300042619 | Bacteria | 4252 |
| 73 | Ga0466690_182271 | 3300042590 | Bacteria | 11589 |
| 74 | Ga0466690_414300 | 3300042590 | Bacteria | 2491 |
| 75 | Ga0466692_149035 | 3300042591 | Bacteria | 7496 |
| 76 | Ga0466691_015894 | 3300042593 | Bacteria | 19005 |
| 77 | Ga0466696_400573 | 3300042596 | Bacteria | 8431 |
| 78 | Ga0466699_204433 | 3300042597 | Bacteria | 21386 |
| 79 | JGI24702J35022_10002563 | 3300002462 | Bacteria | 11046 |
| 80 | JGI24700J35501_10930349 | 3300002508 | Bacteria | 13233 |
| 81 | Ga0068305_10002513 | 3300005083 | Bacteria | 10642 |
| 82 | Ga0466706_234984 | 3300042599 | Bacteria | 2038 |
| 83 | Ga0466719_375880 | 3300042606 | Bacteria | 8945 |
| 84 | Ga0466722_033648 | 3300042609 | Bacteria | 24401 |
| 85 | Ga0466722_046817 | 3300042609 | Bacteria | 10035 |
| 86 | Ga0466722_079491 | 3300042609 | Bacteria | 30706 |
| 87 | Ga0466722_252522 | 3300042609 | Bacteria | 17363 |
| 88 | Ga0123357_10024116 | 3300009784 | Bacteria | 8184 |
| 89 | Ga0123357_10069161 | 3300009784 | Bacteria | 4694 |
| 90 | Ga0123357_10167349 | 3300009784 | Bacteria | 2613 |
| 91 | Ga0123353_10421989 | 3300010167 | Bacteria | 1976 |
| 92 | Ga0466735_069018 | 3300042624 | Bacteria | 12884 |
| 93 | Ga0466703_090560 | 3300042636 | Bacteria | 7493 |
| 94 | Ga0466703_325115 | 3300042636 | Bacteria | 26641 |
| 95 | Ga0466703_377160 | 3300042636 | Bacteria | 5780 |
| 96 | Ga0466704_191993 | 3300042643 | Bacteria | 3619 |
| 97 | Ga0466708_313111 | 3300042652 | Bacteria | 2770 |
| 98 | Ga0466733_158447 | 3300042659 | Bacteria | 4291 |
| 99 | Ga0466711_154232 | 3300042615 | Bacteria | 21041 |
| 100 | Ga0466711_193271 | 3300042615 | Bacteria | 5713 |
| 101 | Ga0466715_008316 | 3300042616 | Bacteria | 12369 |
| 102 | Ga0466715_080952 | 3300042616 | Bacteria | 10505 |
| 103 | Ga0466723_063054 | 3300042618 | Bacteria | 16177 |
| 104 | Ga0466726_124520 | 3300042619 | Bacteria | 3465 |
| 105 | Ga0466726_152915 | 3300042619 | Bacteria | 1707 |
| 106 | Ga0466728_106763 | 3300042620 | Bacteria | 4671 |
| 107 | Ga0466728_128979 | 3300042620 | Bacteria | 16119 |
| 108 | Ga0466690_069039 | 3300042590 | Bacteria | 2425 |
| 109 | Ga0466692_136396 | 3300042591 | Bacteria | 7805 |
| 110 | Ga0466691_043623 | 3300042593 | Bacteria | 12379 |
| 111 | Ga0466691_085069 | 3300042593 | Bacteria | 9789 |
| 112 | Ga0466694_276161 | 3300042594 | Bacteria | 3554 |
| 113 | Ga0466694_331376 | 3300042594 | Bacteria | 7497 |
| 114 | Ga0466696_194307 | 3300042596 | Bacteria | 1576 |
| 115 | JGI24698J34947_10000311 | 3300002449 | Bacteria | 21367 |
| 116 | JGI24702J35022_10005530 | 3300002462 | Bacteria | 7367 |
| 117 | Ga0466706_115181 | 3300042599 | Bacteria | 5704 |
| 118 | Ga0466713_148679 | 3300042602 | Bacteria | 8253 |
| 119 | Ga0466719_071308 | 3300042606 | Bacteria | 22950 |
| 120 | Ga0123356_10000311 | 3300010049 | Bacteria | 55758 |
| 121 | Ga0123353_10043299 | 3300010167 | Bacteria | 7130 |
| 122 | Ga0123353_10092738 | 3300010167 | Bacteria | 4865 |
| 123 | Ga0123353_10220167 | 3300010167 | Bacteria | 2969 |
| 124 | Ga0123353_10379399 | 3300010167 | Bacteria | 2115 |
| 125 | Ga0466703_190093 | 3300042636 | Bacteria | 19996 |
| 126 | Ga0466704_037660 | 3300042643 | Bacteria | 8668 |
| 127 | Ga0466704_047167 | 3300042643 | Unclassified | 9842 |
| 128 | Ga0466704_074608 | 3300042643 | Bacteria | 4190 |
| 129 | Ga0466708_050563 | 3300042652 | Bacteria | 6830 |
| 130 | Ga0466708_089309 | 3300042652 | Bacteria | 8529 |
| 131 | Ga0466727_319435 | 3300042655 | Bacteria | 3778 |
| 132 | Ga0466705_256299 | 3300042612 | Bacteria | 4204 |
| 133 | Ga0466733_015083 | 3300042659 | Bacteria | 10440 |
| 134 | Ga0466733_141867 | 3300042659 | Bacteria | 123412 |
| 135 | Ga0466712_090500 | 3300042614 | Bacteria | 3871 |
| 136 | Ga0466711_101703 | 3300042615 | Bacteria | 5388 |
| 137 | Ga0466715_119055 | 3300042616 | Bacteria | 4805 |
| 138 | Ga0466715_137057 | 3300042616 | Bacteria | 11101 |
| 139 | Ga0466723_214764 | 3300042618 | Bacteria | 2835 |
| 140 | Ga0466728_371921 | 3300042620 | Bacteria | 5368 |
| 141 | Ga0264413_105293 | 3300024493 | Bacteria | 8827 |
| 142 | Ga0466690_077395 | 3300042590 | Bacteria | 5414 |
| 143 | Ga0466690_212340 | 3300042590 | Bacteria | 3651 |
| 144 | Ga0466692_062636 | 3300042591 | Bacteria | 20543 |
| 145 | Ga0466692_078639 | 3300042591 | Bacteria | 28934 |
| 146 | Ga0466692_190941 | 3300042591 | Bacteria | 24770 |
| 147 | Ga0466696_038560 | 3300042596 | Bacteria | 3308 |
| 148 | JGI24698J34947_10000844 | 3300002449 | Bacteria | 15391 |
| 149 | JGI24698J34947_10001401 | 3300002449 | Bacteria | 12687 |
| 150 | JGI24695J34938_10004997 | 3300002450 | Bacteria | 8447 |
| 151 | JGI24702J35022_10021836 | 3300002462 | Bacteria | 3469 |
| 152 | Ga0466706_048226 | 3300042599 | Bacteria | 2941 |
| 153 | Ga0466706_057411 | 3300042599 | Bacteria | 1830 |
| 154 | Ga0466716_096833 | 3300042605 | Bacteria | 2586 |
| 155 | Ga0466716_183059 | 3300042605 | Bacteria | 11787 |
| 156 | Ga0466716_241455 | 3300042605 | Bacteria | 7661 |
| 157 | Ga0466719_083469 | 3300042606 | Bacteria | 16677 |
| 158 | Ga0466719_153775 | 3300042606 | Bacteria | 18188 |
| 159 | Ga0466703_154507 | 3300042636 | Bacteria | 3083 |
| 160 | Ga0466708_080234 | 3300042652 | Bacteria | 26683 |
| 161 | Ga0466705_135232 | 3300042612 | Bacteria | 5233 |
| 162 | Ga0466733_151161 | 3300042659 | Bacteria | 29907 |
| 163 | Ga0466711_135568 | 3300042615 | Bacteria | 4751 |
| 164 | Ga0466715_221854 | 3300042616 | Bacteria | 10369 |
| 165 | Ga0466718_005249 | 3300042617 | Bacteria | 1592 |
| 166 | Ga0466723_275897 | 3300042618 | Bacteria | 48405 |
| 167 | Ga0466728_046240 | 3300042620 | Bacteria | 12403 |
| 168 | Ga0264413_107900 | 3300024493 | Bacteria | 21212 |
| 169 | Ga0466691_031473 | 3300042593 | Bacteria | 27972 |
| 170 | Ga0466691_071395 | 3300042593 | Bacteria | 11120 |
| 171 | Ga0466694_143074 | 3300042594 | Bacteria | 3605 |
| 172 | Ga0466694_344845 | 3300042594 | Bacteria | 10641 |
| 173 | Ga0466699_016273 | 3300042597 | Bacteria | 38876 |
| 174 | Ga0466707_381078 | 3300042601 | Bacteria | 5131 |
| 175 | Ga0466716_173219 | 3300042605 | Bacteria | 15506 |
| 176 | Ga0466716_173272 | 3300042605 | Bacteria | 4047 |
| 177 | Ga0466719_188711 | 3300042606 | Bacteria | 26920 |
| 178 | Ga0466722_011281 | 3300042609 | Bacteria | 2009 |
| 179 | Ga0466722_088066 | 3300042609 | Bacteria | 6249 |
| 180 | Ga0466722_216463 | 3300042609 | Bacteria | 1836 |
| 181 | Ga0123355_10001173 | 3300009826 | Bacteria | 36366 |
| 182 | Ga0466704_034160 | 3300042643 | Bacteria | 21086 |
| 183 | Ga0466704_494162 | 3300042643 | Bacteria | 8763 |
| 184 | Ga0466704_497388 | 3300042643 | Bacteria | 17431 |
| 185 | Ga0466709_133115 | 3300042648 | Bacteria | 8235 |
| 186 | Ga0466708_009706 | 3300042652 | Bacteria | 37452 |
| 187 | Ga0466727_070191 | 3300042655 | Bacteria | 6560 |
| 188 | Ga0466705_102067 | 3300042612 | Bacteria | 3658 |
| 189 | Ga0466705_295223 | 3300042612 | Bacteria | 3457 |
| 190 | Ga0466712_009968 | 3300042614 | Bacteria | 14444 |
| 191 | Ga0466712_113890 | 3300042614 | Bacteria | 23988 |
| 192 | Ga0466715_589773 | 3300042616 | Bacteria | 3825 |
| 193 | Ga0466723_130167 | 3300042618 | Bacteria | 26116 |
| 194 | Ga0466723_230578 | 3300042618 | Bacteria | 9345 |
| 195 | Ga0466726_258114 | 3300042619 | Bacteria | 6162 |
| 196 | Ga0466726_378031 | 3300042619 | Bacteria | 9752 |
| 197 | Ga0466726_481632 | 3300042619 | Bacteria | 3491 |
| 198 | Ga0466728_044375 | 3300042620 | Bacteria | 6478 |
| 199 | Ga0466728_165444 | 3300042620 | Bacteria | 4580 |
| 200 | Ga0466729_074404 | 3300042621 | Bacteria | 2308 |
| 201 | Ga0466690_185632 | 3300042590 | Bacteria | 5893 |
| 202 | Ga0466691_109239 | 3300042593 | Bacteria | 13044 |
| 203 | Ga0466691_216602 | 3300042593 | Bacteria | 11761 |
| 204 | Ga0466699_045351 | 3300042597 | Bacteria | 9522 |
| 205 | Ga0466699_294130 | 3300042597 | Bacteria | 1947 |
| 206 | JGI24698J34947_10030129 | 3300002449 | Unclassified | 2863 |
| 207 | JGI24695J34938_10011666 | 3300002450 | Bacteria | 4718 |
| 208 | Ga0466713_081135 | 3300042602 | Bacteria | 5253 |
| 209 | Ga0466716_360259 | 3300042605 | Bacteria | 10623 |
| 210 | Ga0466719_036455 | 3300042606 | Bacteria | 14384 |
| 211 | Ga0466719_241226 | 3300042606 | Bacteria | 2881 |
| 212 | Ga0466719_280052 | 3300042606 | Bacteria | 47041 |
| 213 | Ga0466722_192706 | 3300042609 | Unclassified | 5686 |
| 214 | Ga0466703_112884 | 3300042636 | Bacteria | 11066 |
| 215 | Ga0466703_278785 | 3300042636 | Bacteria | 14127 |
| 216 | Ga0466703_396107 | 3300042636 | Bacteria | 6631 |
| 217 | Ga0466704_251313 | 3300042643 | Bacteria | 2924 |
| 218 | Ga0466708_098256 | 3300042652 | Bacteria | 28318 |
| 219 | Ga0466708_417990 | 3300042652 | Bacteria | 4093 |
| 220 | Ga0466727_044708 | 3300042655 | Bacteria | 7692 |
| 221 | Ga0466705_193018 | 3300042612 | Bacteria | 3641 |
| 222 | Ga0466711_178220 | 3300042615 | Bacteria | 22392 |
| 223 | Ga0466711_494338 | 3300042615 | Bacteria | 30381 |
| 224 | Ga0466718_081003 | 3300042617 | Bacteria | 1870 |
| 225 | Ga0466723_077151 | 3300042618 | Bacteria | 8571 |
| 226 | Ga0466723_261106 | 3300042618 | Bacteria | 6221 |
| 227 | Ga0466723_347225 | 3300042618 | Bacteria | 4181 |
| 228 | Ga0466726_479138 | 3300042619 | Bacteria | 4231 |
| 229 | Ga0456237_0001231 | 3300041968 | Bacteria | 4046 |
| 230 | Ga0466690_125805 | 3300042590 | Bacteria | 9360 |
| 231 | Ga0466690_404926 | 3300042590 | Unclassified | 1480 |
| 232 | Ga0466693_011464 | 3300042592 | Bacteria | 9076 |
| 233 | Ga0466691_030467 | 3300042593 | Unclassified | 8725 |
| 234 | Ga0466696_159979 | 3300042596 | Bacteria | 3980 |
| 235 | JGI24698J34947_10027490 | 3300002449 | Bacteria | 3018 |
| 236 | Ga0068305_10039001 | 3300005083 | Bacteria | 6115 |
| 237 | Ga0466701_085102 | 3300042598 | Bacteria | 1659 |
| 238 | Ga0466719_360745 | 3300042606 | Bacteria | 15263 |
| 239 | Ga0466722_047702 | 3300042609 | Unclassified | 6033 |
| 240 | Ga0466722_085234 | 3300042609 | Bacteria | 3462 |
| 241 | Ga0466722_199810 | 3300042609 | Bacteria | 2803 |
| 242 | Ga0466722_240565 | 3300042609 | Bacteria | 1730 |
| 243 | Ga0466722_248307 | 3300042609 | Bacteria | 2153 |
| 244 | Ga0466703_261473 | 3300042636 | Bacteria | 7164 |
| 245 | Ga0466704_021590 | 3300042643 | Bacteria | 3685 |
| 246 | Ga0466704_073831 | 3300042643 | Bacteria | 2907 |
| 247 | Ga0466704_088226 | 3300042643 | Bacteria | 5296 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00534 | GO:0016757 | glycosyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.