Protein Family IF06844
Metagenome
Isolate
115
Members
43
Samples
109
Scaffolds
97.29
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_165019|Ga0466722_165019_690_977
- Length
- 95 aa
- Sequence
- MKSVKTTVWDPVEYLETEKDITLYLEEVFKIGNTELIITAIGDVARARKAMTKAAGVSRTSLYQSLSEDGRPAFETVVKVAESLGYKLTLVPLAR
Sample Types
Isolate
5.2%
Metagenome
94.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
55.0%
Kalotermitidae
20.0%
Unclassified
12.5%
Rhinotermitidae
7.5%
Termopsidae
5.0%
Taxonomy
Archaea
0
Bacteria
53
Eukaryota
0
Viruses
0
Unclassified
62
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 8 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 26 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 42 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_010293 | 3300042659 | Unclassified | 1189 |
| 2 | Ga0466723_079421 | 3300042618 | Unclassified | 2466 |
| 3 | Ga0264413_100115 | 3300024493 | Bacteria | 8461 |
| 4 | Ga0456237_0020206 | 3300041968 | Unclassified | 923 |
| 5 | Ga0466690_057140 | 3300042590 | Bacteria | 30420 |
| 6 | Ga0466695_190263 | 3300042595 | Bacteria | 1048 |
| 7 | Ga0466698_393645 | 3300042610 | Unclassified | 1079 |
| 8 | Ga0123356_10223163 | 3300010049 | Unclassified | 1942 |
| 9 | Ga0123356_10498237 | 3300010049 | Unclassified | 1374 |
| 10 | Ga0123356_13826478 | 3300010049 | Unclassified | 520 |
| 11 | Ga0123353_11273471 | 3300010167 | Unclassified | 957 |
| 12 | Ga0466732_017777 | 3300042656 | Bacteria | 3228 |
| 13 | Ga0466712_010302 | 3300042614 | Unclassified | 21726 |
| 14 | Ga0265387_1021005 | 3300024582 | Unclassified | 979 |
| 15 | Ga0466722_178367 | 3300042609 | Unclassified | 1876 |
| 16 | Ga0466702_303576 | 3300042635 | Bacteria | 1075 |
| 17 | Ga0123356_10548180 | 3300010049 | Bacteria | 1317 |
| 18 | Ga0123356_11260929 | 3300010049 | Unclassified | 903 |
| 19 | Ga0123356_12236294 | 3300010049 | Unclassified | 684 |
| 20 | Ga0072940_1075488 | 3300005200 | Bacteria | 3069 |
| 21 | Ga0466705_050018 | 3300042612 | Bacteria | 4311 |
| 22 | Ga0466732_239659 | 3300042656 | Bacteria | 2543 |
| 23 | Ga0264413_109955 | 3300024493 | Unclassified | 2202 |
| 24 | Ga0415639_041523 | 3300038395 | Bacteria | 4158 |
| 25 | Ga0466691_051487 | 3300042593 | Bacteria | 1187 |
| 26 | Ga0466694_015169 | 3300042594 | Bacteria | 1076 |
| 27 | Ga0466716_066052 | 3300042605 | Unclassified | 1282 |
| 28 | Ga0466721_142470 | 3300042608 | Unclassified | 1191 |
| 29 | Ga0466722_165019 | 3300042609 | Bacteria | 3532 |
| 30 | Ga0466698_077776 | 3300042610 | Unclassified | 1367 |
| 31 | Ga0466704_008034 | 3300042643 | Bacteria | 3750 |
| 32 | Ga0123356_10750318 | 3300010049 | Bacteria | 1146 |
| 33 | Ga0123356_11524530 | 3300010049 | Unclassified | 825 |
| 34 | Ga0123353_10997769 | 3300010167 | Bacteria | 1125 |
| 35 | JGI24698J34947_10104201 | 3300002449 | Unclassified | 1267 |
| 36 | Ga0466712_038529 | 3300042614 | Unclassified | 1166 |
| 37 | Ga0466699_215788 | 3300042597 | Bacteria | 4368 |
| 38 | Ga0466719_210468 | 3300042606 | Unclassified | 2075 |
| 39 | Ga0466702_244550 | 3300042635 | Unclassified | 1239 |
| 40 | Ga0466727_058020 | 3300042655 | Bacteria | 1510 |
| 41 | Ga0123356_10073951 | 3300010049 | Bacteria | 3206 |
| 42 | Ga0123356_10097246 | 3300010049 | Bacteria | 2817 |
| 43 | Ga0123356_10115107 | 3300010049 | Unclassified | 2605 |
| 44 | Ga0123356_10258448 | 3300010049 | Bacteria | 1824 |
| 45 | Ga0123353_11484283 | 3300010167 | Unclassified | 865 |
| 46 | Ga0123353_11693396 | 3300010167 | Unclassified | 792 |
| 47 | Ga0072941_1020718 | 3300005201 | Unclassified | 11191 |
| 48 | Ga0466705_122401 | 3300042612 | Bacteria | 3187 |
| 49 | Ga0466718_066344 | 3300042617 | Bacteria | 3417 |
| 50 | Ga0466726_055688 | 3300042619 | Bacteria | 2016 |
| 51 | Ga0466728_120353 | 3300042620 | Unclassified | 1714 |
| 52 | Ga0415639_003145 | 3300038395 | Bacteria | 3957 |
| 53 | Ga0466699_144651 | 3300042597 | Unclassified | 1033 |
| 54 | Ga0466699_325388 | 3300042597 | Bacteria | 11687 |
| 55 | Ga0466717_227548 | 3300042604 | Bacteria | 7660 |
| 56 | Ga0466719_171334 | 3300042606 | Bacteria | 1584 |
| 57 | Ga0466721_141795 | 3300042608 | Unclassified | 1232 |
| 58 | Ga0466722_222992 | 3300042609 | Unclassified | 2236 |
| 59 | Ga0466704_584559 | 3300042643 | Unclassified | 2565 |
| 60 | Ga0123356_10280619 | 3300010049 | Unclassified | 1761 |
| 61 | Ga0123356_11248969 | 3300010049 | Unclassified | 908 |
| 62 | Ga0123353_10342580 | 3300010167 | Unclassified | 2257 |
| 63 | Ga0123353_10956773 | 3300010167 | Unclassified | 1157 |
| 64 | Ga0123353_12135731 | 3300010167 | Unclassified | 680 |
| 65 | JGI24698J34947_10022964 | 3300002449 | Unclassified | 3339 |
| 66 | JGI24698J34947_10046483 | 3300002449 | Unclassified | 2207 |
| 67 | Ga0466718_036802 | 3300042617 | Bacteria | 4102 |
| 68 | Ga0466728_150798 | 3300042620 | Bacteria | 2788 |
| 69 | Ga0466729_178980 | 3300042621 | Unclassified | 1257 |
| 70 | Ga0415639_034633 | 3300038395 | Unclassified | 1130 |
| 71 | Ga0466694_123832 | 3300042594 | Unclassified | 1367 |
| 72 | Ga0466717_145833 | 3300042604 | Unclassified | 1018 |
| 73 | Ga0466722_070581 | 3300042609 | Bacteria | 12152 |
| 74 | Ga0466722_196046 | 3300042609 | Unclassified | 1531 |
| 75 | Ga0123355_11555758 | 3300009826 | Unclassified | 641 |
| 76 | Ga0123356_10457356 | 3300010049 | Unclassified | 1425 |
| 77 | Ga0123356_11438526 | 3300010049 | Unclassified | 849 |
| 78 | Ga0123353_11006290 | 3300010167 | Unclassified | 1119 |
| 79 | Ga0123353_13361459 | 3300010167 | Unclassified | 509 |
| 80 | Ga0123354_10062618 | 3300010882 | Bacteria | 5476 |
| 81 | Ga0123354_10190248 | 3300010882 | Bacteria | 2301 |
| 82 | JGI24698J34947_10050796 | 3300002449 | Unclassified | 2089 |
| 83 | JGI24705J35276_12226856 | 3300002504 | Unclassified | 2913 |
| 84 | Ga0072941_1004171 | 3300005201 | Bacteria | 25127 |
| 85 | Ga0466694_162675 | 3300042594 | Unclassified | 2630 |
| 86 | Ga0466720_071471 | 3300042607 | Bacteria | 4406 |
| 87 | Ga0123356_10231934 | 3300010049 | Bacteria | 1911 |
| 88 | Ga0123356_10295304 | 3300010049 | Unclassified | 1723 |
| 89 | Ga0123356_13547672 | 3300010049 | Unclassified | 540 |
| 90 | Ga0123353_10113986 | 3300010167 | Bacteria | 4352 |
| 91 | Ga0123354_10103588 | 3300010882 | Unclassified | 3826 |
| 92 | JGI24698J34947_10016246 | 3300002449 | Bacteria | 4042 |
| 93 | JGI24695J34938_10260742 | 3300002450 | Unclassified | 738 |
| 94 | Ga0072941_1136584 | 3300005201 | Bacteria | 727 |
| 95 | Ga0466712_233495 | 3300042614 | Bacteria | 9700 |
| 96 | Ga0466712_254044 | 3300042614 | Unclassified | 1913 |
| 97 | Ga0466718_145318 | 3300042617 | Bacteria | 4755 |
| 98 | Ga0466693_429685 | 3300042592 | Unclassified | 1219 |
| 99 | Ga0466720_018038 | 3300042607 | Bacteria | 5541 |
| 100 | Ga0466720_130234 | 3300042607 | Bacteria | 1918 |
| 101 | Ga0466702_010439 | 3300042635 | Bacteria | 9659 |
| 102 | Ga0466704_284768 | 3300042643 | Unclassified | 1064 |
| 103 | Ga0466704_457510 | 3300042643 | Unclassified | 1608 |
| 104 | Ga0466727_162178 | 3300042655 | Unclassified | 1261 |
| 105 | Ga0123356_11153668 | 3300010049 | Unclassified | 942 |
| 106 | Ga0123353_10311934 | 3300010167 | Bacteria | 2393 |
| 107 | Ga0123353_11146212 | 3300010167 | Bacteria | 1027 |
| 108 | Ga0123353_11682393 | 3300010167 | Unclassified | 796 |
| 109 | JGI24698J34947_10000894 | 3300002449 | Bacteria | 15102 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF21716 | dnstrm_HI1420 | Probable addiction module antidote protein | 6 | 91 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.