Protein Family IF06829
Metagenome
Isolate
209
Members
64
Samples
191
Scaffolds
378.93
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_141283|Ga0466722_141283_2379_3692
- Length
- 437 aa
- Sequence
- MRSPAFFNHCLHIQNTFVIDTAFLRIKVGNIIEREGRRGVNIDIFNTFAPEISRIIKAASRMKKVFVSGCYDMLHSGHVAFFEEAASHGELYVGIGSDRTICELKARKPVNTDAERLYMVKALRAVRDAWINRGGGVIDFLEEIHALKPDIFFVNSDGHSPVKEQLCRDLGIEYIVSKRIPHGALPVRSSTALREECRIPYRIDLAGGWLDQPFVSKHHAGAVLTVSIEPDYEFNDRSGMSTSSRKKAIELWHTDIPEGDREKQAKTLFCFENPPGTKYVSGSQDSLGIVYPGLNRLYYQGGYWPETIESVNDPELLQWIEKRLWLIPLFPRVATYDVLADTRVTPEEVARLSRAADDCWQAIRSKDVTAWGKAHSASFEAQIAMFPNMVSPEILRVLEKYKPNVLGWKLSGAGGGGYFVFVSEQPIARAIQIRIRR
Sample Types
Isolate
8.6%
Metagenome
91.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.6%
Kalotermitidae
22.2%
Blattidae
15.9%
Unclassified
11.1%
Rhinotermitidae
6.3%
Termopsidae
6.3%
Hydrophilidae
3.2%
Passalidae
3.2%
Hodotermitidae
1.6%
Tenebrionidae
1.6%
Taxonomy
Archaea
1
Bacteria
201
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 10 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 14 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 15 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 28 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 45 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 50 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 51 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 52 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 53 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 56 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 57 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 58 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 59 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 60 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 61 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 62 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 63 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 64 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_198378 | 3300042612 | Bacteria | 14888 |
| 2 | Ga0466704_189038 | 3300042643 | Bacteria | 10977 |
| 3 | Ga0466727_113759 | 3300042655 | Bacteria | 15347 |
| 4 | Ga0466727_220111 | 3300042655 | Bacteria | 43243 |
| 5 | Ga0466707_348831 | 3300042601 | Bacteria | 2103 |
| 6 | Ga0466713_080967 | 3300042602 | Bacteria | 10571 |
| 7 | Ga0466713_099472 | 3300042602 | Bacteria | 53957 |
| 8 | Ga0466722_151588 | 3300042609 | Bacteria | 7743 |
| 9 | Ga0123356_10081513 | 3300010049 | Bacteria | 3061 |
| 10 | Ga0123354_10259669 | 3300010882 | Bacteria | 1738 |
| 11 | Ga0466715_432401 | 3300042616 | Bacteria | 5863 |
| 12 | Ga0466715_642914 | 3300042616 | Bacteria | 17581 |
| 13 | Ga0466723_193043 | 3300042618 | Bacteria | 34490 |
| 14 | Ga0466726_098369 | 3300042619 | Unclassified | 3031 |
| 15 | JGI24696J40584_12961250 | 3300002834 | Bacteria | 12617 |
| 16 | Ga0466733_062296 | 3300042659 | Bacteria | 3658 |
| 17 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 18 | Ga0466735_107120 | 3300042624 | Bacteria | 2279 |
| 19 | Ga0466703_055116 | 3300042636 | Bacteria | 1914 |
| 20 | Ga0466704_174598 | 3300042643 | Bacteria | 13596 |
| 21 | Ga0466709_231727 | 3300042648 | Bacteria | 7628 |
| 22 | Ga0466727_150110 | 3300042655 | Bacteria | 20444 |
| 23 | Ga0466727_220175 | 3300042655 | Bacteria | 2783 |
| 24 | Ga0466701_017652 | 3300042598 | Bacteria | 77230 |
| 25 | Ga0466706_050745 | 3300042599 | Bacteria | 10034 |
| 26 | Ga0466707_224813 | 3300042601 | Bacteria | 6037 |
| 27 | Ga0466707_240421 | 3300042601 | Bacteria | 1563 |
| 28 | Ga0466713_109231 | 3300042602 | Bacteria | 188899 |
| 29 | Ga0466696_064871 | 3300042596 | Bacteria | 53075 |
| 30 | Ga0466696_287535 | 3300042596 | Bacteria | 43348 |
| 31 | Ga0466711_158297 | 3300042615 | Bacteria | 1847 |
| 32 | Ga0466723_125880 | 3300042618 | Bacteria | 16503 |
| 33 | 2227466589 | 2225789004 | Bacteria | 5121 |
| 34 | JGI24702J35022_10000047 | 3300002462 | Bacteria | 51139 |
| 35 | JGI24702J35022_10001125 | 3300002462 | Bacteria | 16621 |
| 36 | Ga0068302_10163359 | 3300005071 | Bacteria | 1705 |
| 37 | Ga0068305_10035166 | 3300005083 | Bacteria | 8771 |
| 38 | Ga0466697_090250 | 3300042611 | Bacteria | 2942 |
| 39 | Ga0466705_017838 | 3300042612 | Bacteria | 7478 |
| 40 | Ga0466703_420301 | 3300042636 | Unclassified | 3692 |
| 41 | Ga0466704_236841 | 3300042643 | Bacteria | 15017 |
| 42 | Ga0466709_242055 | 3300042648 | Bacteria | 39824 |
| 43 | Ga0466708_302402 | 3300042652 | Bacteria | 34492 |
| 44 | Ga0466727_047170 | 3300042655 | Bacteria | 83253 |
| 45 | Ga0466706_216299 | 3300042599 | Bacteria | 2335 |
| 46 | Ga0466700_357253 | 3300042600 | Bacteria | 5637 |
| 47 | Ga0466707_165483 | 3300042601 | Bacteria | 32826 |
| 48 | Ga0466713_008112 | 3300042602 | Bacteria | 16127 |
| 49 | Ga0466713_104700 | 3300042602 | Bacteria | 45952 |
| 50 | Ga0466716_349737 | 3300042605 | Bacteria | 18598 |
| 51 | Ga0466719_052340 | 3300042606 | Bacteria | 15916 |
| 52 | Ga0466690_040533 | 3300042590 | Bacteria | 11330 |
| 53 | Ga0466696_302916 | 3300042596 | Bacteria | 25646 |
| 54 | Ga0123357_10034719 | 3300009784 | Bacteria | 6856 |
| 55 | Ga0123354_10000698 | 3300010882 | Bacteria | 35854 |
| 56 | Ga0466710_037372 | 3300042613 | Bacteria | 2278 |
| 57 | Ga0466710_170267 | 3300042613 | Bacteria | 14748 |
| 58 | Ga0466711_006966 | 3300042615 | Bacteria | 5800 |
| 59 | Ga0466715_514647 | 3300042616 | Unclassified | 2656 |
| 60 | Ga0466726_414861 | 3300042619 | Bacteria | 1400 |
| 61 | Ga0466728_371680 | 3300042620 | Bacteria | 8915 |
| 62 | IMNBL1DRAFT_c0000136 | 3300000062 | Bacteria | 65757 |
| 63 | JGI24702J35022_10014503 | 3300002462 | Bacteria | 4348 |
| 64 | Ga0466705_326106 | 3300042612 | Bacteria | 40770 |
| 65 | Ga0466733_099882 | 3300042659 | Bacteria | 1987 |
| 66 | Ga0466733_120796 | 3300042659 | Bacteria | 6227 |
| 67 | Ga0466703_269553 | 3300042636 | Bacteria | 2597 |
| 68 | Ga0466704_059052 | 3300042643 | Bacteria | 32672 |
| 69 | Ga0466707_106179 | 3300042601 | Bacteria | 3900 |
| 70 | Ga0466716_402076 | 3300042605 | Bacteria | 4154 |
| 71 | Ga0466656_229341 | 3300042550 | Bacteria | 1753 |
| 72 | Ga0466690_198924 | 3300042590 | Bacteria | 34985 |
| 73 | Ga0466691_127886 | 3300042593 | Bacteria | 16442 |
| 74 | Ga0466696_324704 | 3300042596 | Bacteria | 1796 |
| 75 | Ga0466711_199160 | 3300042615 | Bacteria | 9042 |
| 76 | Ga0466723_164268 | 3300042618 | Bacteria | 2857 |
| 77 | Ga0466723_246960 | 3300042618 | Bacteria | 1546 |
| 78 | Ga0466726_324529 | 3300042619 | Unclassified | 2857 |
| 79 | Ga0466728_470260 | 3300042620 | Bacteria | 2372 |
| 80 | 2227239116 | 2225789004 | Bacteria | 7264 |
| 81 | 2227450255 | 2225789004 | Bacteria | 5423 |
| 82 | JGI24705J35276_12238234 | 3300002504 | Bacteria | 17623 |
| 83 | Ga0068305_10031331 | 3300005083 | Bacteria | 12573 |
| 84 | Ga0068305_10049092 | 3300005083 | Bacteria | 12491 |
| 85 | Ga0466733_024002 | 3300042659 | Bacteria | 39250 |
| 86 | Ga0466733_084365 | 3300042659 | Bacteria | 13107 |
| 87 | Ga0466735_069331 | 3300042624 | Bacteria | 3763 |
| 88 | Ga0466735_098137 | 3300042624 | Bacteria | 3787 |
| 89 | Ga0466735_216824 | 3300042624 | Bacteria | 1683 |
| 90 | Ga0466704_031012 | 3300042643 | Bacteria | 5617 |
| 91 | Ga0466704_258026 | 3300042643 | Bacteria | 4075 |
| 92 | Ga0466704_469167 | 3300042643 | Bacteria | 9925 |
| 93 | Ga0466727_081946 | 3300042655 | Bacteria | 4526 |
| 94 | Ga0466701_070840 | 3300042598 | Bacteria | 15102 |
| 95 | Ga0466706_194383 | 3300042599 | Bacteria | 20630 |
| 96 | Ga0466707_100671 | 3300042601 | Bacteria | 1748 |
| 97 | Ga0466713_075457 | 3300042602 | Bacteria | 24128 |
| 98 | Ga0466713_079899 | 3300042602 | Unclassified | 2654 |
| 99 | Ga0466713_137778 | 3300042602 | Bacteria | 1407 |
| 100 | Ga0466719_010632 | 3300042606 | Bacteria | 12106 |
| 101 | Ga0466719_072148 | 3300042606 | Bacteria | 13566 |
| 102 | Ga0466719_362466 | 3300042606 | Bacteria | 2896 |
| 103 | Ga0466722_121330 | 3300042609 | Bacteria | 42758 |
| 104 | Ga0466656_237373 | 3300042550 | Bacteria | 15096 |
| 105 | Ga0466705_499614 | 3300042612 | Bacteria | 6118 |
| 106 | Ga0466711_263921 | 3300042615 | Unclassified | 8092 |
| 107 | Ga0466715_049285 | 3300042616 | Bacteria | 2799 |
| 108 | Ga0466723_082290 | 3300042618 | Bacteria | 16638 |
| 109 | Ga0466726_345088 | 3300042619 | Bacteria | 7018 |
| 110 | Ga0466729_151163 | 3300042621 | Bacteria | 3399 |
| 111 | Ga0072940_1422941 | 3300005200 | Bacteria | 1687 |
| 112 | Ga0072941_1071670 | 3300005201 | Bacteria | 2587 |
| 113 | Ga0466697_139971 | 3300042611 | Bacteria | 122800 |
| 114 | Ga0466705_175319 | 3300042612 | Bacteria | 4960 |
| 115 | Ga0466705_318463 | 3300042612 | Bacteria | 3111 |
| 116 | Ga0466733_061998 | 3300042659 | Bacteria | 12301 |
| 117 | Ga0466735_046657 | 3300042624 | Bacteria | 6530 |
| 118 | Ga0466735_123679 | 3300042624 | Bacteria | 2376 |
| 119 | Ga0466735_152001 | 3300042624 | Bacteria | 3530 |
| 120 | Ga0466703_140271 | 3300042636 | Bacteria | 55996 |
| 121 | Ga0466704_084380 | 3300042643 | Bacteria | 14804 |
| 122 | Ga0466709_080488 | 3300042648 | Bacteria | 7623 |
| 123 | Ga0466709_276147 | 3300042648 | Bacteria | 8212 |
| 124 | Ga0466706_048425 | 3300042599 | Bacteria | 4552 |
| 125 | Ga0466707_005911 | 3300042601 | Bacteria | 16512 |
| 126 | Ga0466707_077745 | 3300042601 | Bacteria | 6464 |
| 127 | Ga0466707_139797 | 3300042601 | Bacteria | 27173 |
| 128 | Ga0466713_129978 | 3300042602 | Bacteria | 70140 |
| 129 | Ga0466713_152626 | 3300042602 | Bacteria | 36770 |
| 130 | Ga0466716_239893 | 3300042605 | Bacteria | 7870 |
| 131 | Ga0466691_082783 | 3300042593 | Bacteria | 28065 |
| 132 | Ga0466696_196337 | 3300042596 | Bacteria | 6822 |
| 133 | Ga0466715_190989 | 3300042616 | Bacteria | 5915 |
| 134 | Ga0466715_250275 | 3300042616 | Bacteria | 7315 |
| 135 | Ga0466715_360885 | 3300042616 | Bacteria | 59521 |
| 136 | Ga0466715_591119 | 3300042616 | Bacteria | 3209 |
| 137 | Ga0466726_069851 | 3300042619 | Bacteria | 5697 |
| 138 | Ga0466726_166912 | 3300042619 | Bacteria | 31769 |
| 139 | Ga0466728_253577 | 3300042620 | Bacteria | 3428 |
| 140 | Ga0466733_041174 | 3300042659 | Bacteria | 1672 |
| 141 | Ga0466733_129506 | 3300042659 | Bacteria | 1981 |
| 142 | Ga0466733_199302 | 3300042659 | Bacteria | 3738 |
| 143 | Ga0466703_039597 | 3300042636 | Bacteria | 3878 |
| 144 | Ga0466708_146402 | 3300042652 | Bacteria | 13887 |
| 145 | Ga0466725_106783 | 3300042654 | Bacteria | 2483 |
| 146 | Ga0466725_119640 | 3300042654 | Bacteria | 6872 |
| 147 | Ga0466727_034358 | 3300042655 | Bacteria | 33712 |
| 148 | Ga0466727_107621 | 3300042655 | Bacteria | 9293 |
| 149 | Ga0466707_070837 | 3300042601 | Bacteria | 19880 |
| 150 | Ga0466713_099183 | 3300042602 | Bacteria | 118109 |
| 151 | Ga0466716_355256 | 3300042605 | Bacteria | 6361 |
| 152 | Ga0466719_210155 | 3300042606 | Bacteria | 9481 |
| 153 | Ga0466722_141283 | 3300042609 | Bacteria | 13906 |
| 154 | Ga0466698_447796 | 3300042610 | Bacteria | 4351 |
| 155 | Ga0466691_064302 | 3300042593 | Bacteria | 3316 |
| 156 | Ga0466696_361792 | 3300042596 | Bacteria | 9269 |
| 157 | Ga0466701_015516 | 3300042598 | Bacteria | 5093 |
| 158 | Ga0466711_084854 | 3300042615 | Bacteria | 10720 |
| 159 | Ga0466711_495588 | 3300042615 | Bacteria | 3351 |
| 160 | Ga0466723_086325 | 3300042618 | Bacteria | 5162 |
| 161 | Ga0466728_425802 | 3300042620 | Bacteria | 19622 |
| 162 | JGI24702J35022_10001384 | 3300002462 | Bacteria | 15078 |
| 163 | Ga0466705_305532 | 3300042612 | Bacteria | 10631 |
| 164 | Ga0466733_024429 | 3300042659 | Bacteria | 8459 |
| 165 | Ga0466731_171351 | 3300042622 | Bacteria | 2078 |
| 166 | Ga0466703_071422 | 3300042636 | Bacteria | 20891 |
| 167 | Ga0466703_076549 | 3300042636 | Bacteria | 30576 |
| 168 | Ga0466703_175205 | 3300042636 | Bacteria | 25111 |
| 169 | Ga0466709_146490 | 3300042648 | Bacteria | 11034 |
| 170 | Ga0466727_087532 | 3300042655 | Bacteria | 2954 |
| 171 | Ga0466707_265242 | 3300042601 | Bacteria | 2392 |
| 172 | Ga0466713_058852 | 3300042602 | Bacteria | 3579 |
| 173 | Ga0466713_100016 | 3300042602 | Bacteria | 46673 |
| 174 | Ga0466716_320267 | 3300042605 | Bacteria | 4289 |
| 175 | Ga0466722_010442 | 3300042609 | Bacteria | 16245 |
| 176 | Ga0466690_023436 | 3300042590 | Bacteria | 9478 |
| 177 | Ga0466690_123938 | 3300042590 | Bacteria | 17302 |
| 178 | Ga0466693_038938 | 3300042592 | Bacteria | 3823 |
| 179 | Ga0123357_10228317 | 3300009784 | Bacteria | 2047 |
| 180 | Ga0123353_10000831 | 3300010167 | Bacteria | 37538 |
| 181 | Ga0466711_343215 | 3300042615 | Bacteria | 7862 |
| 182 | Ga0466715_498121 | 3300042616 | Bacteria | 9304 |
| 183 | Ga0466715_633167 | 3300042616 | Unclassified | 12647 |
| 184 | Ga0466715_638566 | 3300042616 | Bacteria | 20374 |
| 185 | Ga0466726_003518 | 3300042619 | Bacteria | 3683 |
| 186 | Ga0466728_129664 | 3300042620 | Archaea | 6871 |
| 187 | Ga0466728_144832 | 3300042620 | Bacteria | 8491 |
| 188 | 2227175255 | 2225789004 | Bacteria | 8139 |
| 189 | JGI24702J35022_10019788 | 3300002462 | Bacteria | 3661 |
| 190 | Ga0068302_10062975 | 3300005071 | Bacteria | 6676 |
| 191 | Ga0068305_10116172 | 3300005083 | Bacteria | 5767 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01467 | CTP_transf_like | Cytidylyltransferase-like | 67 | 162 | 0.76 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.