Protein Family IF06735

Metagenome Isolate
193 Members
54 Samples
176 Scaffolds
458.62 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_026469|Ga0466722_026469_16347_17879
Length
510 aa
Sequence
MASLSPFILSLFAFELCAKLKYNIMKREYNLGYIVPITLVATLGGLLFGYDTAVISGAEKGLEAFFLQAGDFKYNKVLHGITSSSALIGCVIGGFLSGLFASRFGRRNSLRFASVLFFLSALGSYNPEFLFFPRGEATQNLLIAFNLYRVLGGIGVGLASAIVPMYIAEISPSSIRGTLVSCNQFAIIFGMLVVYFVNFLIMGDHTNPIIDKGVLNPSSDPWTIATGWRYMFASEAYVAAVFGILLFFVPRTPRYLVLIGQNEQALSVLTKVNGESRAKAILADIISTSKEKTEKLFAYGILVVIIGILLSVFQQAIGINAVLYYAPRIFESAGADGMLSTVIMGFVNISFTVVAIVTVDKFGRKPLLIIGSVGMAVGAFAVMLCGHFKLIDPNAVVTDAALTWSSLIPIISVMVYAAFFMMSWGPICWVLISEIFPNTIRGKAVAIAVAAQWIFNYIVSSTFPPLYDFSPMIAYGLYGTMCVLAALFVWKLVPETKGKTLEDMNKLWRK

📊 Sample Types

Isolate 8.8%
Metagenome 91.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 26.4%
Unclassified 18.9%
Termitidae 15.1%
Termopsidae 7.5%
Blattidae 7.5%
Rhinotermitidae 5.7%
Tenebrionidae 3.8%
Passalidae 3.8%
Apidae 3.8%
Hodotermitidae 1.9%
Armadillidiidae 1.9%
Hydrophilidae 1.9%
Nymphalidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 185
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
11 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
14 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
15 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
16 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
17 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
25 3004672520 Bacteroides sp. 51 Isolate Blattidae
26 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
27 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
28 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
29 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3004667792 Bacteroides sp. 519 Isolate Blattidae
34 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3004677695 Bacteroides sp. 214 Isolate Blattidae
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
44 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
45 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
48 2922326829 Bacteroides sp. 224 Isolate Blattidae
49 2775507278 Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 Isolate Nymphalidae
50 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
51 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_378213 3300042612 Bacteria 34876
2 Ga0466706_140574 3300042599 Bacteria 2411
3 Ga0466706_188194 3300042599 Bacteria 37930
4 Ga0466706_208550 3300042599 Bacteria 17688
5 Ga0466706_271762 3300042599 Bacteria 15716
6 Ga0466707_146398 3300042601 Bacteria 26743
7 Ga0466713_124834 3300042602 Bacteria 50546
8 Ga0466708_008295 3300042652 Bacteria 3357
9 Ga0466727_044212 3300042655 Bacteria 34323
10 Ga0466727_327973 3300042655 Bacteria 5119
11 Ga0466711_014437 3300042615 Bacteria 7077
12 Ga0466711_186770 3300042615 Bacteria 4917
13 Ga0466711_334516 3300042615 Bacteria 25865
14 Ga0466723_210541 3300042618 Bacteria 6815
15 Ga0562379_0082 3300056790 Bacteria 350556
16 Ga0466706_017038 3300042599 Bacteria 50770
17 Ga0466706_104816 3300042599 Bacteria 21327
18 Ga0466706_163065 3300042599 Bacteria 10604
19 Ga0466706_183336 3300042599 Bacteria 11871
20 Ga0466719_299430 3300042606 Bacteria 5944
21 Ga0466722_045823 3300042609 Bacteria 22242
22 Ga0466722_194235 3300042609 Bacteria 17088
23 Ga0466735_067449 3300042624 Bacteria 8697
24 Ga0466703_293096 3300042636 Bacteria 19440
25 Ga0466703_308081 3300042636 Bacteria 2000
26 Ga0466715_382034 3300042616 Bacteria 3858
27 Ga0466715_574759 3300042616 Bacteria 26976
28 Ga0466723_313196 3300042618 Bacteria 7133
29 Ga0466729_076706 3300042621 Bacteria 2418
30 Ga0466690_258942 3300042590 Bacteria 3954
31 Ga0466692_044884 3300042591 Bacteria 6577
32 Ga0466692_108647 3300042591 Bacteria 182579
33 Ga0466692_178790 3300042591 Bacteria 1874
34 2227588505 2225789004 Bacteria 13056
35 Ga0466706_099767 3300042599 Unclassified 3063
36 Ga0466700_369835 3300042600 Bacteria 46737
37 Ga0466707_021567 3300042601 Bacteria 12610
38 Ga0466707_048793 3300042601 Bacteria 2104
39 Ga0466707_280455 3300042601 Bacteria 2756
40 Ga0466707_402557 3300042601 Bacteria 1603
41 Ga0466713_007773 3300042602 Bacteria 19088
42 Ga0466713_097987 3300042602 Bacteria 3892
43 Ga0466716_348744 3300042605 Bacteria 7774
44 Ga0466722_031252 3300042609 Bacteria 6501
45 Ga0123355_10007301 3300009826 Unclassified 16538
46 Ga0466729_264517 3300042621 Bacteria 26130
47 Ga0466703_146284 3300042636 Bacteria 6048
48 Ga0466704_196700 3300042643 Bacteria 5784
49 Ga0466709_390589 3300042648 Bacteria 49108
50 Ga0466708_141900 3300042652 Bacteria 6334
51 Ga0466711_028897 3300042615 Bacteria 15505
52 Ga0466726_251974 3300042619 Bacteria 3517
53 Ga0466726_415820 3300042619 Bacteria 3311
54 Ga0466728_116793 3300042620 Bacteria 97907
55 Ga0160443_100028 3300012848 Bacteria 368417
56 Ga0466690_028914 3300042590 Bacteria 8668
57 Ga0466692_194567 3300042591 Bacteria 2806
58 Ga0466733_183611 3300042659 Bacteria 4860
59 Ga0562376_4699 3300056857 Unclassified 10671
60 Ga0466706_288799 3300042599 Bacteria 30426
61 Ga0466707_199124 3300042601 Bacteria 8039
62 Ga0466713_055337 3300042602 Bacteria 34181
63 Ga0466713_114913 3300042602 Bacteria 2691
64 Ga0466713_154972 3300042602 Bacteria 7839
65 Ga0466719_117801 3300042606 Bacteria 3299
66 Ga0466722_026469 3300042609 Bacteria 18008
67 Ga0123357_10145853 3300009784 Bacteria 2892
68 Ga0123356_10008866 3300010049 Bacteria 9957
69 Ga0466735_067511 3300042624 Bacteria 1624
70 Ga0466735_081998 3300042624 Bacteria 2071
71 Ga0466735_157774 3300042624 Unclassified 8030
72 Ga0466735_200393 3300042624 Bacteria 1967
73 Ga0466727_007953 3300042655 Bacteria 20470
74 Ga0466727_324901 3300042655 Bacteria 1917
75 Ga0466711_083927 3300042615 Bacteria 8200
76 Ga0466711_147709 3300042615 Bacteria 38159
77 Ga0466711_351328 3300042615 Bacteria 39391
78 Ga0466726_062025 3300042619 Bacteria 12997
79 Ga0466726_170485 3300042619 Bacteria 2095
80 Ga0466726_330688 3300042619 Bacteria 7434
81 Ga0466729_102428 3300042621 Bacteria 5509
82 Ga0466729_141377 3300042621 Bacteria 4112
83 Ga0466692_058412 3300042591 Bacteria 13556
84 IMNBL1DRAFT_c0015908 3300000062 Bacteria 3241
85 Ga0068302_10265013 3300005071 Bacteria 3901
86 Ga0068305_10009904 3300005083 Bacteria 41398
87 Ga0466705_301331 3300042612 Bacteria 7209
88 Ga0466733_161739 3300042659 Bacteria 4038
89 Ga0466706_059714 3300042599 Bacteria 2928
90 Ga0466706_074053 3300042599 Bacteria 16825
91 Ga0466706_074239 3300042599 Bacteria 7384
92 Ga0466706_112758 3300042599 Bacteria 4750
93 Ga0466707_117911 3300042601 Bacteria 2160
94 Ga0466707_337597 3300042601 Bacteria 5523
95 Ga0466713_000139 3300042602 Bacteria 1935
96 Ga0466713_121621 3300042602 Bacteria 61883
97 Ga0466714_035363 3300042603 Bacteria 4449
98 Ga0466714_092658 3300042603 Bacteria 6271
99 Ga0466719_107525 3300042606 Unclassified 1882
100 Ga0466719_210192 3300042606 Bacteria 4383
101 Ga0466722_159367 3300042609 Bacteria 5918
102 Ga0466711_227825 3300042615 Bacteria 191336
103 Ga0466711_447184 3300042615 Bacteria 22005
104 Ga0466690_023626 3300042590 Bacteria 3384
105 Ga0466692_029801 3300042591 Bacteria 11515
106 Ga0466692_090197 3300042591 Bacteria 19390
107 Ga0466691_075904 3300042593 Bacteria 6401
108 Ga0068305_10307139 3300005083 Bacteria 2422
109 Ga0466733_095398 3300042659 Bacteria 7035
110 Ga0466706_051070 3300042599 Bacteria 13786
111 Ga0466706_067463 3300042599 Bacteria 21419
112 Ga0466713_022472 3300042602 Bacteria 48965
113 Ga0466713_111746 3300042602 Bacteria 2039
114 Ga0466713_143316 3300042602 Bacteria 9021
115 Ga0466719_148389 3300042606 Bacteria 25322
116 Ga0466735_042045 3300042624 Bacteria 4206
117 Ga0466735_073620 3300042624 Unclassified 1426
118 Ga0466735_156247 3300042624 Bacteria 2230
119 Ga0466704_036280 3300042643 Bacteria 12387
120 Ga0466704_330131 3300042643 Bacteria 2847
121 Ga0466709_302022 3300042648 Bacteria 2447
122 Ga0466708_082955 3300042652 Bacteria 55601
123 Ga0466715_042591 3300042616 Bacteria 14628
124 Ga0466690_341696 3300042590 Bacteria 8001
125 Ga0466692_138452 3300042591 Bacteria 3508
126 Ga0466692_204610 3300042591 Bacteria 20338
127 2227550762 2225789004 Bacteria 2853
128 IMNBL1DRAFT_c0002642 3300000062 Bacteria 12268
129 Ga0068305_10002010 3300005083 Bacteria 184777
130 Ga0068305_10031783 3300005083 Bacteria 6880
131 Ga0466707_026923 3300042601 Bacteria 3098
132 Ga0466707_029580 3300042601 Bacteria 3776
133 Ga0466707_327841 3300042601 Bacteria 9241
134 Ga0466713_138552 3300042602 Unclassified 2110
135 Ga0466719_006711 3300042606 Bacteria 13342
136 Ga0466722_132468 3300042609 Bacteria 12492
137 Ga0466729_240601 3300042621 Bacteria 7123
138 Ga0466735_008071 3300042624 Bacteria 2129
139 Ga0466735_068279 3300042624 Bacteria 3203
140 Ga0466703_427382 3300042636 Bacteria 1821
141 Ga0466725_060986 3300042654 Bacteria 2399
142 Ga0466727_093527 3300042655 Bacteria 8910
143 Ga0466727_154835 3300042655 Bacteria 7319
144 Ga0466711_078677 3300042615 Bacteria 6423
145 Ga0466715_167940 3300042616 Bacteria 11594
146 Ga0466715_219389 3300042616 Bacteria 32024
147 Ga0466726_133879 3300042619 Bacteria 3218
148 Ga0160453_100207 3300012814 Bacteria 57341
149 Ga0466690_171369 3300042590 Bacteria 11350
150 Ga0466691_112635 3300042593 Bacteria 5913
151 Ga0466691_224364 3300042593 Bacteria 31650
152 Ga0466696_052042 3300042596 Bacteria 11930
153 JGI24699J35502_11134204 3300002509 Bacteria 55998
154 Ga0562379_2098 3300056790 Bacteria 18218
155 Ga0466706_106379 3300042599 Bacteria 42196
156 Ga0466706_243992 3300042599 Bacteria 2751
157 Ga0466707_017541 3300042601 Bacteria 5678
158 Ga0466707_144042 3300042601 Bacteria 10251
159 Ga0466722_063333 3300042609 Bacteria 5631
160 Ga0466735_088061 3300042624 Bacteria 5844
161 Ga0466704_463254 3300042643 Bacteria 5866
162 Ga0466709_024483 3300042648 Bacteria 22052
163 Ga0466708_119234 3300042652 Unclassified 5862
164 Ga0466727_077268 3300042655 Bacteria 71904
165 Ga0466727_310703 3300042655 Bacteria 9579
166 Ga0466715_019101 3300042616 Bacteria 29215
167 Ga0466715_611912 3300042616 Bacteria 34451
168 Ga0466726_370776 3300042619 Bacteria 2177
169 Ga0466728_232869 3300042620 Bacteria 5827
170 Ga0466729_073110 3300042621 Bacteria 4927
171 Ga0466692_183742 3300042591 Bacteria 15201
172 Ga0466691_047205 3300042593 Bacteria 13605
173 Ga0466696_270387 3300042596 Bacteria 17241
174 JGI24699J35502_11134194 3300002509 Bacteria 51469
175 Ga0068302_10014797 3300005071 Bacteria 2632
176 Ga0068302_10153320 3300005071 Bacteria 4637

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00083 Sugar_tr Sugar (and other) transporter 38 508 0.93
PF07690 MFS_1 Major Facilitator Superfamily 69 452 0.79

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.