Protein Family IF06704
Metagenome
Isolate
152
Members
59
Samples
148
Scaffolds
240.07
Avg Length
Representative Sequence
- ID
- 3300042608|Ga0466721_233805|Ga0466721_233805_34_879
- Length
- 281 aa
- Sequence
- VKRKNFARSLKRKTSEGSILQIIYYKHIQTKNIMEEIKFQLSNLRLSGMARQWQTLEETRRTGELSLADGMALLLQAETDWRHENRYARLLKNAAFRYQASMEEINGEAGRGIDRMLLSRLATGDYIRKGETVLITGASGCGKSFLASALGHQACRQGYAVTYHNMHKLPVKLKLARMDSSIIKLFDRMAKTDLLIIDDFGLTALQGQQQTDFLEIIEDRHTKRSTIIASQLPVTSWFDVIGEAVIADAILDRIVHTAHRFERGEFKKKNVNLSACLDGHK
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
59.3%
Kalotermitidae
11.1%
Termopsidae
7.4%
Drosophilidae
7.4%
Rhinotermitidae
3.7%
Armadillidiidae
3.7%
Unclassified
3.7%
Bombycidae
1.9%
Blattidae
1.9%
Taxonomy
Archaea
0
Bacteria
122
Eukaryota
0
Viruses
1
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 32 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 35 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 40 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 43 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 44 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 50 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 51 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 54 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 55 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 56 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 57 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 58 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 59 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_136929 | 3300042611 | Unclassified | 1309 |
| 2 | Ga0466697_268488 | 3300042611 | Bacteria | 3072 |
| 3 | Ga0466731_433095 | 3300042622 | Unclassified | 1025 |
| 4 | Ga0466734_088047 | 3300042623 | Bacteria | 2194 |
| 5 | Ga0466702_082767 | 3300042635 | Bacteria | 1039 |
| 6 | Ga0466725_099386 | 3300042654 | Bacteria | 3233 |
| 7 | Ga0466717_219517 | 3300042604 | Unclassified | 3086 |
| 8 | Ga0466698_248513 | 3300042610 | Bacteria | 2725 |
| 9 | Ga0123357_10128372 | 3300009784 | Bacteria | 3167 |
| 10 | Ga0123354_10169829 | 3300010882 | Bacteria | 2544 |
| 11 | Ga0415639_025439 | 3300038395 | Bacteria | 1877 |
| 12 | Ga0466693_014428 | 3300042592 | Bacteria | 3273 |
| 13 | Ga0466695_205829 | 3300042595 | Bacteria | 2314 |
| 14 | Ga0466699_261154 | 3300042597 | Bacteria | 1714 |
| 15 | AustNasuHG_c1014560 | 3300000089 | Unclassified | 2670 |
| 16 | JGI24702J35022_10060806 | 3300002462 | Bacteria | 2020 |
| 17 | JGI24705J35276_12082999 | 3300002504 | Bacteria | 978 |
| 18 | Ga0072940_1105721 | 3300005200 | Bacteria | 2728 |
| 19 | Ga0466697_163197 | 3300042611 | Bacteria | 4160 |
| 20 | Ga0466735_166209 | 3300042624 | Bacteria | 1491 |
| 21 | Ga0466715_297766 | 3300042616 | Bacteria | 2450 |
| 22 | Ga0466713_009671 | 3300042602 | Unclassified | 5109 |
| 23 | Ga0466719_404694 | 3300042606 | Bacteria | 3574 |
| 24 | Ga0466720_108889 | 3300042607 | Unclassified | 1457 |
| 25 | Ga0466721_218082 | 3300042608 | Bacteria | 3262 |
| 26 | Ga0466721_232651 | 3300042608 | Bacteria | 4165 |
| 27 | Ga0466722_155177 | 3300042609 | Bacteria | 4433 |
| 28 | Ga0466698_121127 | 3300042610 | Bacteria | 2726 |
| 29 | Ga0466698_313161 | 3300042610 | Bacteria | 1462 |
| 30 | Ga0466698_474780 | 3300042610 | Bacteria | 1496 |
| 31 | Ga0123353_10485717 | 3300010167 | Unclassified | 1805 |
| 32 | Ga0123353_11478325 | 3300010167 | Bacteria | 867 |
| 33 | Ga0265387_1001954 | 3300024582 | Bacteria | 2932 |
| 34 | Ga0466693_103689 | 3300042592 | Unclassified | 1600 |
| 35 | Ga0466696_059957 | 3300042596 | Bacteria | 2102 |
| 36 | Ga0466699_075419 | 3300042597 | Bacteria | 1237 |
| 37 | JGI24698J34947_10030509 | 3300002449 | Bacteria | 2843 |
| 38 | JGI24698J34947_10030656 | 3300002449 | Bacteria | 2835 |
| 39 | JGI24698J34947_10095145 | 3300002449 | Bacteria | 1355 |
| 40 | JGI24702J35022_10014367 | 3300002462 | Bacteria | 4367 |
| 41 | Ga0072941_1193542 | 3300005201 | Bacteria | 1262 |
| 42 | Ga0074309_1000530 | 3300005314 | Bacteria | 2781 |
| 43 | Ga0466734_019317 | 3300042623 | Bacteria | 2726 |
| 44 | Ga0466703_023668 | 3300042636 | Bacteria | 2599 |
| 45 | Ga0466727_153403 | 3300042655 | Bacteria | 2960 |
| 46 | Ga0466710_217713 | 3300042613 | Bacteria | 4123 |
| 47 | Ga0466701_041016 | 3300042598 | Bacteria | 2181 |
| 48 | Ga0466717_275833 | 3300042604 | Bacteria | 2943 |
| 49 | Ga0466721_233805 | 3300042608 | Unclassified | 1021 |
| 50 | Ga0466698_034054 | 3300042610 | Bacteria | 5069 |
| 51 | Ga0123355_10508127 | 3300009826 | Bacteria | 1482 |
| 52 | Ga0160433_100024 | 3300012846 | Bacteria | 185997 |
| 53 | Ga0466656_132036 | 3300042550 | Bacteria | 1219 |
| 54 | AustNasuHG_c1013986 | 3300000089 | Bacteria | 2740 |
| 55 | JGI24698J34947_10022806 | 3300002449 | Bacteria | 3352 |
| 56 | JGI24702J35022_10029362 | 3300002462 | Bacteria | 2952 |
| 57 | JGI24702J35022_10030640 | 3300002462 | Bacteria | 2886 |
| 58 | Ga0068302_10338027 | 3300005071 | Unclassified | 1986 |
| 59 | Ga0466733_019340 | 3300042659 | Bacteria | 1874 |
| 60 | Ga0466733_213974 | 3300042659 | Bacteria | 3017 |
| 61 | Ga0466734_097104 | 3300042623 | Bacteria | 1858 |
| 62 | Ga0466710_413972 | 3300042613 | Bacteria | 3116 |
| 63 | Ga0466726_005143 | 3300042619 | Bacteria | 1815 |
| 64 | Ga0466729_080451 | 3300042621 | Bacteria | 1691 |
| 65 | Ga0466701_034881 | 3300042598 | Bacteria | 3102 |
| 66 | Ga0466717_014230 | 3300042604 | Bacteria | 1719 |
| 67 | Ga0123357_10415285 | 3300009784 | Unclassified | 1207 |
| 68 | Ga0123353_10224567 | 3300010167 | Bacteria | 2934 |
| 69 | Ga0123353_11037489 | 3300010167 | Bacteria | 1097 |
| 70 | Ga0123354_10085109 | 3300010882 | Bacteria | 4433 |
| 71 | Ga0160444_100069 | 3300012841 | Bacteria | 137709 |
| 72 | Ga0415639_190989 | 3300038395 | Unclassified | 1241 |
| 73 | Ga0466657_109687 | 3300042582 | Bacteria | 2864 |
| 74 | Ga0466694_354670 | 3300042594 | Bacteria | 3023 |
| 75 | Ga0104048_1000456 | 3300007143 | Bacteria | 6855 |
| 76 | Ga0466697_089335 | 3300042611 | Bacteria | 1368 |
| 77 | Ga0466697_194500 | 3300042611 | Unclassified | 1266 |
| 78 | Ga0466731_273071 | 3300042622 | Bacteria | 2679 |
| 79 | Ga0466727_127003 | 3300042655 | Unclassified | 1023 |
| 80 | Ga0466712_297956 | 3300042614 | Unclassified | 3384 |
| 81 | Ga0466707_344322 | 3300042601 | Bacteria | 3433 |
| 82 | Ga0466713_048526 | 3300042602 | Bacteria | 4206 |
| 83 | Ga0466719_085121 | 3300042606 | Unclassified | 1940 |
| 84 | Ga0466721_222096 | 3300042608 | Bacteria | 3615 |
| 85 | Ga0466698_452562 | 3300042610 | Unclassified | 1208 |
| 86 | Ga0123356_10077161 | 3300010049 | Bacteria | 3141 |
| 87 | Ga0123356_10574600 | 3300010049 | Unclassified | 1290 |
| 88 | Ga0123356_11265473 | 3300010049 | Bacteria | 902 |
| 89 | Ga0123354_10372764 | 3300010882 | Unclassified | 1243 |
| 90 | Ga0264413_145046 | 3300024493 | Bacteria | 3061 |
| 91 | Ga0466656_138596 | 3300042550 | Unclassified | 3101 |
| 92 | Ga0466656_224851 | 3300042550 | Bacteria | 5358 |
| 93 | Ga0466656_266718 | 3300042550 | Bacteria | 3289 |
| 94 | Ga0466694_041768 | 3300042594 | Bacteria | 1017 |
| 95 | Ga0466702_235329 | 3300042635 | Bacteria | 2722 |
| 96 | Ga0466724_54710 | 3300042649 | Bacteria | 1333 |
| 97 | Ga0466725_040789 | 3300042654 | Bacteria | 1451 |
| 98 | Ga0466710_008881 | 3300042613 | Bacteria | 1851 |
| 99 | Ga0466701_016077 | 3300042598 | Bacteria | 1888 |
| 100 | Ga0466720_032123 | 3300042607 | Bacteria | 3542 |
| 101 | Ga0466721_110691 | 3300042608 | Bacteria | 1464 |
| 102 | Ga0466698_352139 | 3300042610 | Bacteria | 3586 |
| 103 | Ga0123356_10113021 | 3300010049 | Unclassified | 2626 |
| 104 | Ga0123356_10231822 | 3300010049 | Bacteria | 1911 |
| 105 | Ga0123353_10012708 | 3300010167 | Unclassified | 12002 |
| 106 | Ga0123354_10333264 | 3300010882 | Bacteria | 1380 |
| 107 | Ga0415639_049793 | 3300038395 | Bacteria | 3261 |
| 108 | Ga0466693_139624 | 3300042592 | Bacteria | 2989 |
| 109 | Ga0466694_284402 | 3300042594 | Unclassified | 1488 |
| 110 | Ga0466694_326073 | 3300042594 | Bacteria | 2193 |
| 111 | Ga0466694_391716 | 3300042594 | Unclassified | 3196 |
| 112 | JGI24702J35022_10027170 | 3300002462 | Viruses | 3079 |
| 113 | Ga0104045_1075086 | 3300007085 | Unclassified | 2203 |
| 114 | Ga0466731_355163 | 3300042622 | Bacteria | 3164 |
| 115 | Ga0466735_008381 | 3300042624 | Bacteria | 1781 |
| 116 | Ga0466703_198235 | 3300042636 | Bacteria | 9668 |
| 117 | Ga0466711_308741 | 3300042615 | Bacteria | 1504 |
| 118 | Ga0466701_037615 | 3300042598 | Bacteria | 1147 |
| 119 | Ga0466701_053416 | 3300042598 | Bacteria | 1433 |
| 120 | Ga0466701_102517 | 3300042598 | Bacteria | 4483 |
| 121 | Ga0466717_004409 | 3300042604 | Bacteria | 4099 |
| 122 | Ga0466721_358750 | 3300042608 | Bacteria | 3183 |
| 123 | Ga0466698_516208 | 3300042610 | Unclassified | 1027 |
| 124 | Ga0466697_016913 | 3300042611 | Bacteria | 1025 |
| 125 | Ga0123356_10087675 | 3300010049 | Unclassified | 2957 |
| 126 | Ga0123353_10001572 | 3300010167 | Bacteria | 28031 |
| 127 | Ga0123354_10391961 | 3300010882 | Bacteria | 1186 |
| 128 | JGI24702J35022_10096297 | 3300002462 | Bacteria | 1615 |
| 129 | JGI24702J35022_10330744 | 3300002462 | Bacteria | 906 |
| 130 | JGI24696J40584_12948099 | 3300002834 | Bacteria | 1985 |
| 131 | Ga0104050_1005419 | 3300007153 | Bacteria | 2529 |
| 132 | Ga0466697_226327 | 3300042611 | Bacteria | 1976 |
| 133 | Ga0466704_060026 | 3300042643 | Bacteria | 2291 |
| 134 | Ga0466724_08167 | 3300042649 | Bacteria | 1546 |
| 135 | Ga0466724_52585 | 3300042649 | Bacteria | 1693 |
| 136 | Ga0466710_082544 | 3300042613 | Bacteria | 1462 |
| 137 | Ga0466710_353821 | 3300042613 | Bacteria | 2458 |
| 138 | Ga0466717_139108 | 3300042604 | Unclassified | 2474 |
| 139 | Ga0466721_098851 | 3300042608 | Unclassified | 1180 |
| 140 | Ga0123355_10308351 | 3300009826 | Bacteria | 2149 |
| 141 | Ga0123356_11124475 | 3300010049 | Bacteria | 953 |
| 142 | Ga0123353_10223256 | 3300010167 | Bacteria | 2944 |
| 143 | Ga0415639_086668 | 3300038395 | Bacteria | 4337 |
| 144 | Ga0466693_001305 | 3300042592 | Bacteria | 4122 |
| 145 | Ga0466694_098899 | 3300042594 | Bacteria | 1549 |
| 146 | Ga0466695_365601 | 3300042595 | Bacteria | 3269 |
| 147 | JGI24702J35022_10046008 | 3300002462 | Bacteria | 2325 |
| 148 | Ga0072940_1056263 | 3300005200 | Bacteria | 2588 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01695 | GO:0005524 | ATP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.