Protein Family IF06698
Metagenome
Isolate
128
Members
51
Samples
125
Scaffolds
330.51
Avg Length
Representative Sequence
- ID
- 3300042608|Ga0466721_155570|Ga0466721_155570_223_1287
- Length
- 354 aa
- Sequence
- MDYRYNLITYKNTGKMNDWQQIDRGRRINIIETVSKETGLSPASIEKDWRVTMALRALFRCDCAEVAVFKGGTSLSKAWNLIERMSEDVDIAVDRSFFGFEGQINRSAITKLRKASCLYIGTSLKSQLTHHLQDMGITGFSLNIPETGDTAADPQIIELKYETLFAEDGDTYIKEKVLIEIGSRSLIEPSKKVEVRSVIANSYPQSSFADPTTPIPTVIPQRTFLEKAFLLHEEFQKPAENIRVERMSRHLYDLERLMDTGFARNALEDISLYQSIVDHRSKLTAISGIDYSTHSPDTINFVPQESIIERWRNDYSFMQANMIYGESLPFEKLIERIKELNGRFREITVRYFFP
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
24.0%
Unclassified
12.0%
Rhinotermitidae
6.0%
Termopsidae
4.0%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
1
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 35 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_016719 | 3300042613 | Bacteria | 1183 |
| 2 | Ga0466723_276543 | 3300042618 | Bacteria | 4540 |
| 3 | Ga0466729_153330 | 3300042621 | Bacteria | 12027 |
| 4 | Ga0466700_021344 | 3300042600 | Bacteria | 2152 |
| 5 | Ga0466713_081769 | 3300042602 | Bacteria | 2277 |
| 6 | Ga0466721_155570 | 3300042608 | Bacteria | 5553 |
| 7 | Ga0466721_289658 | 3300042608 | Bacteria | 7032 |
| 8 | Ga0466722_187380 | 3300042609 | Bacteria | 52405 |
| 9 | Ga0466697_043723 | 3300042611 | Bacteria | 2056 |
| 10 | Ga0123353_10045280 | 3300010167 | Bacteria | 6980 |
| 11 | Ga0123353_10371024 | 3300010167 | Bacteria | 2145 |
| 12 | Ga0466692_129811 | 3300042591 | Bacteria | 3622 |
| 13 | Ga0466695_279991 | 3300042595 | Bacteria | 1209 |
| 14 | JGI24696J40584_12961375 | 3300002834 | Bacteria | 14472 |
| 15 | Ga0072941_1285594 | 3300005201 | Bacteria | 1678 |
| 16 | Ga0466697_120371 | 3300042611 | Unclassified | 1783 |
| 17 | Ga0466697_130023 | 3300042611 | Bacteria | 3246 |
| 18 | Ga0466726_118820 | 3300042619 | Bacteria | 7087 |
| 19 | Ga0466722_127030 | 3300042609 | Bacteria | 1973 |
| 20 | Ga0123353_10309537 | 3300010167 | Bacteria | 2405 |
| 21 | Ga0123353_10814297 | 3300010167 | Bacteria | 1287 |
| 22 | Ga0466693_256002 | 3300042592 | Bacteria | 1673 |
| 23 | Ga0466693_439813 | 3300042592 | Bacteria | 1390 |
| 24 | JGI24695J34938_10088939 | 3300002450 | Bacteria | 1268 |
| 25 | JGI24705J35276_12222606 | 3300002504 | Bacteria | 2435 |
| 26 | JGI24705J35276_12236178 | 3300002504 | Bacteria | 7605 |
| 27 | Ga0068305_10136157 | 3300005083 | Bacteria | 4231 |
| 28 | Ga0466705_107643 | 3300042612 | Bacteria | 5952 |
| 29 | Ga0466730_000198 | 3300042625 | Bacteria | 2712 |
| 30 | Ga0466703_082845 | 3300042636 | Bacteria | 2251 |
| 31 | Ga0466704_057446 | 3300042643 | Bacteria | 36351 |
| 32 | Ga0466704_118067 | 3300042643 | Bacteria | 17751 |
| 33 | Ga0466709_178779 | 3300042648 | Bacteria | 4004 |
| 34 | Ga0466716_477808 | 3300042605 | Bacteria | 2158 |
| 35 | Ga0466719_090166 | 3300042606 | Unclassified | 2779 |
| 36 | Ga0123357_10096417 | 3300009784 | Bacteria | 3830 |
| 37 | Ga0123356_10198761 | 3300010049 | Bacteria | 2043 |
| 38 | Ga0123353_10001316 | 3300010167 | Bacteria | 30447 |
| 39 | Ga0466657_353958 | 3300042582 | Unclassified | 2722 |
| 40 | Ga0466693_043938 | 3300042592 | Bacteria | 1279 |
| 41 | Ga0466693_091418 | 3300042592 | Bacteria | 2654 |
| 42 | Ga0466694_025560 | 3300042594 | Bacteria | 3424 |
| 43 | JGI24702J35022_10001319 | 3300002462 | Bacteria | 15423 |
| 44 | JGI24705J35276_12212967 | 3300002504 | Bacteria | 1907 |
| 45 | Ga0123357_10002062 | 3300009784 | Bacteria | 22044 |
| 46 | Ga0466732_285364 | 3300042656 | Bacteria | 5038 |
| 47 | Ga0466711_310970 | 3300042615 | Bacteria | 3161 |
| 48 | Ga0466704_153119 | 3300042643 | Bacteria | 6789 |
| 49 | Ga0466701_048772 | 3300042598 | Bacteria | 4023 |
| 50 | Ga0466717_205902 | 3300042604 | Bacteria | 3458 |
| 51 | Ga0466720_211993 | 3300042607 | Bacteria | 1762 |
| 52 | Ga0466722_180382 | 3300042609 | Unclassified | 3616 |
| 53 | Ga0123356_10215783 | 3300010049 | Bacteria | 1971 |
| 54 | Ga0123353_10044782 | 3300010167 | Bacteria | 7016 |
| 55 | Ga0123353_10146952 | 3300010167 | Unclassified | 3768 |
| 56 | Ga0123353_10558934 | 3300010167 | Bacteria | 1648 |
| 57 | Ga0123354_10200057 | 3300010882 | Bacteria | 2200 |
| 58 | Ga0466657_023041 | 3300042582 | Bacteria | 1507 |
| 59 | Ga0466693_000904 | 3300042592 | Bacteria | 2322 |
| 60 | Ga0466691_092663 | 3300042593 | Bacteria | 22785 |
| 61 | JGI24698J34947_10057628 | 3300002449 | Bacteria | 1926 |
| 62 | JGI24702J35022_10094602 | 3300002462 | Bacteria | 1629 |
| 63 | Ga0466711_472988 | 3300042615 | Bacteria | 11365 |
| 64 | Ga0466735_059296 | 3300042624 | Bacteria | 2905 |
| 65 | Ga0466704_476303 | 3300042643 | Bacteria | 4335 |
| 66 | Ga0466704_522247 | 3300042643 | Bacteria | 6338 |
| 67 | Ga0466709_300101 | 3300042648 | Bacteria | 2371 |
| 68 | Ga0466707_369906 | 3300042601 | Bacteria | 6288 |
| 69 | Ga0466716_294453 | 3300042605 | Unclassified | 1852 |
| 70 | Ga0466719_094834 | 3300042606 | Bacteria | 2745 |
| 71 | Ga0123356_10086375 | 3300010049 | Bacteria | 2978 |
| 72 | Ga0123353_10006225 | 3300010167 | Bacteria | 15861 |
| 73 | Ga0123354_10200881 | 3300010882 | Bacteria | 2192 |
| 74 | Ga0466656_373776 | 3300042550 | Bacteria | 4663 |
| 75 | Ga0466690_099282 | 3300042590 | Bacteria | 2727 |
| 76 | Ga0466692_058734 | 3300042591 | Bacteria | 4431 |
| 77 | JGI24702J35022_10037377 | 3300002462 | Bacteria | 2593 |
| 78 | JGI24696J40584_12958617 | 3300002834 | Bacteria | 4272 |
| 79 | Ga0466705_483438 | 3300042612 | Bacteria | 4326 |
| 80 | Ga0466710_077114 | 3300042613 | Bacteria | 3157 |
| 81 | Ga0466711_029491 | 3300042615 | Bacteria | 24445 |
| 82 | Ga0466735_150200 | 3300042624 | Bacteria | 1313 |
| 83 | Ga0466701_037794 | 3300042598 | Unclassified | 3834 |
| 84 | Ga0466706_245891 | 3300042599 | Bacteria | 10088 |
| 85 | Ga0466700_140705 | 3300042600 | Bacteria | 4330 |
| 86 | Ga0466698_274232 | 3300042610 | Bacteria | 1921 |
| 87 | Ga0466697_034145 | 3300042611 | Bacteria | 1549 |
| 88 | Ga0123356_10332664 | 3300010049 | Bacteria | 1636 |
| 89 | Ga0123356_10479092 | 3300010049 | Bacteria | 1397 |
| 90 | Ga0123354_10123365 | 3300010882 | Unclassified | 3327 |
| 91 | Ga0466693_171150 | 3300042592 | Bacteria | 2269 |
| 92 | JGI24705J35276_12187546 | 3300002504 | Bacteria | 1431 |
| 93 | Ga0466697_163963 | 3300042611 | Bacteria | 2170 |
| 94 | Ga0466723_118323 | 3300042618 | Bacteria | 2257 |
| 95 | Ga0466703_050454 | 3300042636 | Bacteria | 2791 |
| 96 | Ga0466704_511556 | 3300042643 | Bacteria | 2439 |
| 97 | Ga0466707_141586 | 3300042601 | Bacteria | 2016 |
| 98 | Ga0466717_159002 | 3300042604 | Bacteria | 2631 |
| 99 | Ga0466717_288561 | 3300042604 | Unclassified | 1546 |
| 100 | Ga0123357_10170710 | 3300009784 | Bacteria | 2574 |
| 101 | Ga0415639_189866 | 3300038395 | Bacteria | 1145 |
| 102 | Ga0466656_255542 | 3300042550 | Bacteria | 1203 |
| 103 | Ga0466690_236981 | 3300042590 | Bacteria | 1140 |
| 104 | Ga0466692_126348 | 3300042591 | Bacteria | 7988 |
| 105 | IMNBL1DRAFT_c0017726 | 3300000062 | Bacteria | 2984 |
| 106 | JGI24702J35022_10005244 | 3300002462 | Bacteria | 7600 |
| 107 | JGI24702J35022_10007545 | 3300002462 | Bacteria | 6226 |
| 108 | Ga0466705_212159 | 3300042612 | Bacteria | 15004 |
| 109 | Ga0466703_256214 | 3300042636 | Bacteria | 1575 |
| 110 | Ga0466708_035375 | 3300042652 | Unclassified | 10767 |
| 111 | Ga0466707_108798 | 3300042601 | Bacteria | 5773 |
| 112 | Ga0466717_260283 | 3300042604 | Bacteria | 1474 |
| 113 | Ga0466716_156043 | 3300042605 | Bacteria | 4033 |
| 114 | Ga0466722_193659 | 3300042609 | Bacteria | 4824 |
| 115 | Ga0123357_10127969 | 3300009784 | Bacteria | 3174 |
| 116 | Ga0123357_10191177 | 3300009784 | Unclassified | 2358 |
| 117 | Ga0123357_10312954 | 3300009784 | Bacteria | 1565 |
| 118 | Ga0123356_10085555 | 3300010049 | Bacteria | 2991 |
| 119 | Ga0123356_10477457 | 3300010049 | Bacteria | 1399 |
| 120 | Ga0123353_10433701 | 3300010167 | Bacteria | 1942 |
| 121 | Ga0123353_10521857 | 3300010167 | Bacteria | 1723 |
| 122 | Ga0466696_215329 | 3300042596 | Bacteria | 3097 |
| 123 | JGI24695J34938_10049221 | 3300002450 | Bacteria | 1853 |
| 124 | JGI24702J35022_10027761 | 3300002462 | Bacteria | 3044 |
| 125 | JGI24696J40584_12948871 | 3300002834 | Viruses | 2033 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042594 | Ga0466694_025560 | Ga0466694_025560_2398_3402 | 291 |
| 2 | 3300042609 | Ga0466722_127030 | Ga0466722_127030_821_1816 | 291 |
| 3 | 3300042636 | Ga0466703_082845 | Ga0466703_082845_625_1509 | 294 |
| 4 | 3300009784 | Ga0123357_10191177 | Ga0123357_101911773 | 303 |
| 5 | 3300010167 | Ga0123353_10045280 | Ga0123353_100452805 | 304 |
| 6 | 3300042590 | Ga0466690_236981 | Ga0466690_236981_15_998 | 304 |
| 7 | 3300042611 | Ga0466697_163963 | Ga0466697_163963_207_1121 | 304 |
| 8 | 3300010167 | Ga0123353_10006225 | Ga0123353_100062255 | 305 |
| 9 | 3300042592 | Ga0466693_439813 | Ga0466693_439813_317_1243 | 308 |
| 10 | 3300002449 | JGI24698J34947_10057628 | JGI24698J34947_100576283 | 309 |
| 11 | 3300042605 | Ga0466716_294453 | Ga0466716_294453_833_1825 | 310 |
| 12 | 3300002462 | JGI24702J35022_10037377 | JGI24702J35022_100373771 | 311 |
| 13 | 3300042595 | Ga0466695_279991 | Ga0466695_279991_261_1196 | 311 |
| 14 | 3300042601 | Ga0466707_369906 | Ga0466707_369906_4955_5953 | 313 |
| 15 | 3300042605 | Ga0466716_477808 | Ga0466716_477808_462_1403 | 313 |
| 16 | 3300042636 | Ga0466703_050454 | Ga0466703_050454_633_1628 | 313 |
| 17 | 3300042643 | Ga0466704_522247 | Ga0466704_522247_1011_2027 | 313 |
| 18 | 3300009784 | Ga0123357_10002062 | Ga0123357_1000206219 | 314 |
| 19 | 3300042592 | Ga0466693_171150 | Ga0466693_171150_278_1291 | 316 |
| 20 | 3300002834 | JGI24696J40584_12961375 | JGI24696J40584_129613754 | 318 |
| 21 | 3300042592 | Ga0466693_256002 | Ga0466693_256002_47_1051 | 319 |
| 22 | 3300009784 | Ga0123357_10312954 | Ga0123357_103129541 | 320 |
| 23 | 3300042625 | Ga0466730_000198 | Ga0466730_000198_1267_2229 | 320 |
| 24 | 3300042604 | Ga0466717_260283 | Ga0466717_260283_153_1169 | 321 |
| 25 | 3300042648 | Ga0466709_300101 | Ga0466709_300101_442_1434 | 322 |
| 26 | 3300042612 | Ga0466705_107643 | Ga0466705_107643_2886_3869 | 327 |
| 27 | 3300042615 | Ga0466711_029491 | Ga0466711_029491_22309_23298 | 329 |
| 28 | 3300042615 | Ga0466711_472988 | Ga0466711_472988_8204_9193 | 329 |
| 29 | 3300042618 | Ga0466723_118323 | Ga0466723_118323_994_2025 | 329 |
| 30 | 3300042652 | Ga0466708_035375 | Ga0466708_035375_2320_3309 | 329 |
| 31 | 3300010049 | Ga0123356_10477457 | Ga0123356_104774572 | 330 |
| 32 | 3300042591 | Ga0466692_058734 | Ga0466692_058734_249_1241 | 330 |
| 33 | 3300042591 | Ga0466692_129811 | Ga0466692_129811_1921_2913 | 330 |
| 34 | 3300042600 | Ga0466700_140705 | Ga0466700_140705_2798_3790 | 330 |
| 35 | 3300042601 | Ga0466707_108798 | Ga0466707_108798_3702_4694 | 330 |
| 36 | 3300042606 | Ga0466719_090166 | Ga0466719_090166_1578_2570 | 330 |
| 37 | 3300042607 | Ga0466720_211993 | Ga0466720_211993_19_1011 | 330 |
| 38 | 3300042611 | Ga0466697_120371 | Ga0466697_120371_336_1328 | 330 |
| 39 | 3300042624 | Ga0466735_059296 | Ga0466735_059296_1120_2112 | 330 |
| 40 | 3300042643 | Ga0466704_057446 | Ga0466704_057446_2075_3067 | 330 |
| 41 | 3300042648 | Ga0466709_178779 | Ga0466709_178779_904_1896 | 330 |
| 42 | 3300002450 | JGI24695J34938_10049221 | JGI24695J34938_100492212 | 331 |
| 43 | 3300009784 | Ga0123357_10127969 | Ga0123357_101279693 | 331 |
| 44 | 3300009784 | Ga0123357_10170710 | Ga0123357_101707104 | 331 |
| 45 | 3300010882 | Ga0123354_10200057 | Ga0123354_102000573 | 331 |
| 46 | 3300010882 | Ga0123354_10200881 | Ga0123354_102008813 | 331 |
| 47 | 3300042550 | Ga0466656_255542 | Ga0466656_255542_92_1087 | 331 |
| 48 | 3300042592 | Ga0466693_091418 | Ga0466693_091418_926_1921 | 331 |
| 49 | 3300042599 | Ga0466706_245891 | Ga0466706_245891_291_1286 | 331 |
| 50 | 3300042604 | Ga0466717_159002 | Ga0466717_159002_883_1878 | 331 |
| 51 | 3300042612 | Ga0466705_212159 | Ga0466705_212159_10711_11706 | 331 |
| 52 | 3300042643 | Ga0466704_118067 | Ga0466704_118067_5328_6323 | 331 |
| 53 | 3300042643 | Ga0466704_476303 | Ga0466704_476303_2776_3771 | 331 |
| 54 | 3300002834 | JGI24696J40584_12948871 | JGI24696J40584_129488711 | 332 |
| 55 | 3300010049 | Ga0123356_10198761 | Ga0123356_101987612 | 332 |
| 56 | 3300042593 | Ga0466691_092663 | Ga0466691_092663_6625_7623 | 332 |
| 57 | 3300042604 | Ga0466717_288561 | Ga0466717_288561_536_1534 | 332 |
| 58 | 3300042609 | Ga0466722_187380 | Ga0466722_187380_6113_7111 | 332 |
| 59 | 3300042611 | Ga0466697_043723 | Ga0466697_043723_684_1682 | 332 |
| 60 | 3300042621 | Ga0466729_153330 | Ga0466729_153330_9653_10651 | 332 |
| 61 | 3300042643 | Ga0466704_511556 | Ga0466704_511556_457_1455 | 332 |
| 62 | 3300005083 | Ga0068305_10136157 | Ga0068305_101361574 | 333 |
| 63 | 3300042590 | Ga0466690_099282 | Ga0466690_099282_529_1545 | 333 |
| 64 | 3300042609 | Ga0466722_193659 | Ga0466722_193659_1836_2837 | 333 |
| 65 | 3300042636 | Ga0466703_256214 | Ga0466703_256214_290_1291 | 333 |
| 66 | 3300042643 | Ga0466704_153119 | Ga0466704_153119_17_1018 | 333 |
| 67 | 3300042600 | Ga0466700_021344 | Ga0466700_021344_893_1897 | 334 |
| 68 | 3300042604 | Ga0466717_205902 | Ga0466717_205902_1887_2891 | 334 |
| 69 | 3300042656 | Ga0466732_285364 | Ga0466732_285364_2757_3761 | 334 |
| 70 | 3300002462 | JGI24702J35022_10007545 | JGI24702J35022_100075455 | 335 |
| 71 | 3300002504 | JGI24705J35276_12187546 | JGI24705J35276_121875462 | 335 |
| 72 | 3300002504 | JGI24705J35276_12236178 | JGI24705J35276_122361783 | 335 |
| 73 | 3300005201 | Ga0072941_1285594 | Ga0072941_12855941 | 335 |
| 74 | 3300042606 | Ga0466719_094834 | Ga0466719_094834_489_1496 | 335 |
| 75 | 3300010049 | Ga0123356_10215783 | Ga0123356_102157833 | 336 |
| 76 | 3300010049 | Ga0123356_10332664 | Ga0123356_103326642 | 336 |
| 77 | 3300010167 | Ga0123353_10521857 | Ga0123353_105218572 | 336 |
| 78 | 3300042550 | Ga0466656_373776 | Ga0466656_373776_3580_4590 | 336 |
| 79 | 3300042592 | Ga0466693_000904 | Ga0466693_000904_866_1876 | 336 |
| 80 | 3300042592 | Ga0466693_043938 | Ga0466693_043938_166_1176 | 336 |
| 81 | 3300042610 | Ga0466698_274232 | Ga0466698_274232_500_1510 | 336 |
| 82 | 3300010049 | Ga0123356_10479092 | Ga0123356_104790922 | 337 |
| 83 | 3300010167 | Ga0123353_10371024 | Ga0123353_103710241 | 337 |
| 84 | 3300038395 | Ga0415639_189866 | Ga0415639_189866_90_1103 | 337 |
| 85 | 3300042582 | Ga0466657_353958 | Ga0466657_353958_32_1045 | 337 |
| 86 | 3300042598 | Ga0466701_037794 | Ga0466701_037794_2606_3619 | 337 |
| 87 | 3300042602 | Ga0466713_081769 | Ga0466713_081769_906_1919 | 337 |
| 88 | 3300042618 | Ga0466723_276543 | Ga0466723_276543_1403_2416 | 337 |
| 89 | 3300002462 | JGI24702J35022_10005244 | JGI24702J35022_100052446 | 338 |
| 90 | 3300002462 | JGI24702J35022_10027761 | JGI24702J35022_100277611 | 338 |
| 91 | 3300002504 | JGI24705J35276_12212967 | JGI24705J35276_122129671 | 338 |
| 92 | 3300009784 | Ga0123357_10096417 | Ga0123357_100964172 | 338 |
| 93 | 3300010049 | Ga0123356_10086375 | Ga0123356_100863752 | 338 |
| 94 | 3300010167 | Ga0123353_10044782 | Ga0123353_100447822 | 338 |
| 95 | 3300010167 | Ga0123353_10146952 | Ga0123353_101469522 | 338 |
| 96 | 3300010167 | Ga0123353_10558934 | Ga0123353_105589342 | 338 |
| 97 | 3300042598 | Ga0466701_048772 | Ga0466701_048772_1699_2715 | 338 |
| 98 | 3300042601 | Ga0466707_141586 | Ga0466707_141586_512_1528 | 338 |
| 99 | 3300042608 | Ga0466721_289658 | Ga0466721_289658_231_1247 | 338 |
| 100 | 3300042611 | Ga0466697_034145 | Ga0466697_034145_322_1338 | 338 |
| 101 | 3300042612 | Ga0466705_483438 | Ga0466705_483438_2479_3495 | 338 |
| 102 | 3300042613 | Ga0466710_016719 | Ga0466710_016719_147_1163 | 338 |
| 103 | 3300042619 | Ga0466726_118820 | Ga0466726_118820_4867_5883 | 338 |
| 104 | 3300000062 | IMNBL1DRAFT_c0017726 | IMNBL1DRAFT_00177266 | 339 |
| 105 | 3300002450 | JGI24695J34938_10088939 | JGI24695J34938_100889391 | 339 |
| 106 | 3300002462 | JGI24702J35022_10001319 | JGI24702J35022_100013192 | 339 |
| 107 | 3300002462 | JGI24702J35022_10094602 | JGI24702J35022_100946022 | 339 |
| 108 | 3300002834 | JGI24696J40584_12958617 | JGI24696J40584_129586172 | 339 |
| 109 | 3300010049 | Ga0123356_10085555 | Ga0123356_100855553 | 339 |
| 110 | 3300010167 | Ga0123353_10001316 | Ga0123353_1000131620 | 339 |
| 111 | 3300010167 | Ga0123353_10309537 | Ga0123353_103095373 | 339 |
| 112 | 3300010167 | Ga0123353_10814297 | Ga0123353_108142972 | 339 |
| 113 | 3300042596 | Ga0466696_215329 | Ga0466696_215329_1773_2792 | 339 |
| 114 | 3300042609 | Ga0466722_180382 | Ga0466722_180382_123_1142 | 339 |
| 115 | 3300042613 | Ga0466710_077114 | Ga0466710_077114_765_1784 | 339 |
| 116 | 3300042624 | Ga0466735_150200 | Ga0466735_150200_119_1138 | 339 |
| 117 | iso_pr_bacteria | 2820737921 | 2820738611 | 339 |
| 118 | iso_pr_bacteria | 2820789850 | 2820790747 | 339 |
| 119 | 3300042605 | Ga0466716_156043 | Ga0466716_156043_2710_3735 | 341 |
| 120 | iso_pr_bacteria | 2820765201 | 2820765483 | 341 |
| 121 | 3300002504 | JGI24705J35276_12222606 | JGI24705J35276_122226062 | 342 |
| 122 | 3300042582 | Ga0466657_023041 | Ga0466657_023041_464_1495 | 343 |
| 123 | 3300042591 | Ga0466692_126348 | Ga0466692_126348_1150_2181 | 343 |
| 124 | 3300042611 | Ga0466697_130023 | Ga0466697_130023_266_1297 | 343 |
| 125 | 3300010882 | Ga0123354_10123365 | Ga0123354_101233652 | 344 |
| 126 | 3300042615 | Ga0466711_310970 | Ga0466711_310970_618_1658 | 346 |
| 127 | 3300010167 | Ga0123353_10433701 | Ga0123353_104337012 | 352 |
| 128 | 3300042608 | Ga0466721_155570 | Ga0466721_155570_223_1287 | 354 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08843 | AbiEii | Nucleotidyl transferase AbiEii toxin, Type IV TA system | 56 | 335 | 0.86 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.89 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.