Protein Family IF06680
Metagenome
Isolate
286
Members
57
Samples
276
Scaffolds
185.15
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_180643|Ga0466720_180643_165_725
- Length
- 186 aa
- Sequence
- MSLQKITLANAKDRFYLEPLSAQSKLQGFKCAVDEYTDYLFKDSIRSLNDHIAKTWLLYEKETGLLTAYMSLIADAIKLSFTTEKELHGLNYPFRTIPAMKIAKLAVDEIFIKKYKGIGTFMIQTAEHLSYGLNKNYIAARFLTVDADIEHNGTVIEFYQKNGFIPNAEFNNKNRKTVSMRKDIFA
Sample Types
Isolate
3.5%
Metagenome
96.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.2%
Kalotermitidae
25.5%
Unclassified
23.6%
Rhinotermitidae
5.5%
Termopsidae
5.5%
Hodotermitidae
1.8%
Taxonomy
Archaea
2
Bacteria
266
Eukaryota
0
Viruses
1
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 2 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 18 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 41 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 42 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 43 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 44 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 52 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 53 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 57 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_157548 | 3300042659 | Bacteria | 1151 |
| 2 | AustNasuHG_c1039660 | 3300000089 | Bacteria | 1165 |
| 3 | JGI24698J34947_10048398 | 3300002449 | Bacteria | 2153 |
| 4 | JGI24698J34947_10164876 | 3300002449 | Bacteria | 903 |
| 5 | Ga0068305_10005655 | 3300005083 | Bacteria | 8853 |
| 6 | Ga0466735_126807 | 3300042624 | Bacteria | 1822 |
| 7 | Ga0466704_011839 | 3300042643 | Bacteria | 1017 |
| 8 | Ga0466709_035930 | 3300042648 | Bacteria | 1548 |
| 9 | Ga0466708_133548 | 3300042652 | Bacteria | 2093 |
| 10 | Ga0466727_141882 | 3300042655 | Bacteria | 3218 |
| 11 | Ga0466727_310303 | 3300042655 | Bacteria | 1060 |
| 12 | Ga0466690_135402 | 3300042590 | Unclassified | 1601 |
| 13 | Ga0466690_264869 | 3300042590 | Bacteria | 1557 |
| 14 | Ga0466692_191402 | 3300042591 | Bacteria | 1535 |
| 15 | Ga0466693_078561 | 3300042592 | Bacteria | 1202 |
| 16 | Ga0466691_023178 | 3300042593 | Bacteria | 1451 |
| 17 | Ga0466696_250263 | 3300042596 | Bacteria | 2571 |
| 18 | Ga0466699_032330 | 3300042597 | Bacteria | 1247 |
| 19 | Ga0466699_054853 | 3300042597 | Bacteria | 1138 |
| 20 | Ga0466712_168404 | 3300042614 | Bacteria | 4716 |
| 21 | Ga0466712_226737 | 3300042614 | Bacteria | 5822 |
| 22 | Ga0466712_240304 | 3300042614 | Bacteria | 1934 |
| 23 | Ga0466711_210280 | 3300042615 | Bacteria | 1388 |
| 24 | Ga0466715_073192 | 3300042616 | Bacteria | 3646 |
| 25 | Ga0466723_368734 | 3300042618 | Bacteria | 2532 |
| 26 | Ga0466726_166698 | 3300042619 | Bacteria | 1080 |
| 27 | Ga0466728_276857 | 3300042620 | Unclassified | 1467 |
| 28 | Ga0466729_045198 | 3300042621 | Bacteria | 1185 |
| 29 | Ga0466719_510960 | 3300042606 | Bacteria | 1904 |
| 30 | Ga0123356_10355613 | 3300010049 | Bacteria | 1590 |
| 31 | Ga0123356_10599959 | 3300010049 | Bacteria | 1266 |
| 32 | Ga0123356_10711619 | 3300010049 | Bacteria | 1173 |
| 33 | Ga0466705_235709 | 3300042612 | Bacteria | 10181 |
| 34 | Ga0466727_348864 | 3300042655 | Bacteria | 1851 |
| 35 | JGI24698J34947_10012352 | 3300002449 | Bacteria | 4680 |
| 36 | JGI24698J34947_10101328 | 3300002449 | Bacteria | 1294 |
| 37 | JGI24698J34947_10139114 | 3300002449 | Bacteria | 1025 |
| 38 | Ga0466729_303054 | 3300042621 | Bacteria | 2089 |
| 39 | Ga0466735_023804 | 3300042624 | Bacteria | 1531 |
| 40 | Ga0466702_330158 | 3300042635 | Bacteria | 13833 |
| 41 | Ga0466703_260876 | 3300042636 | Bacteria | 1725 |
| 42 | Ga0466709_328099 | 3300042648 | Bacteria | 25608 |
| 43 | Ga0466708_366681 | 3300042652 | Bacteria | 1993 |
| 44 | Ga0466727_278790 | 3300042655 | Bacteria | 1064 |
| 45 | Ga0264413_111277 | 3300024493 | Bacteria | 7466 |
| 46 | Ga0415639_035757 | 3300038395 | Bacteria | 1030 |
| 47 | Ga0415639_147455 | 3300038395 | Bacteria | 1749 |
| 48 | Ga0466690_057353 | 3300042590 | Bacteria | 2060 |
| 49 | Ga0466690_417357 | 3300042590 | Bacteria | 5182 |
| 50 | Ga0466692_020272 | 3300042591 | Bacteria | 1665 |
| 51 | Ga0466692_044855 | 3300042591 | Bacteria | 1322 |
| 52 | Ga0466692_079580 | 3300042591 | Bacteria | 1593 |
| 53 | Ga0466691_110090 | 3300042593 | Bacteria | 1274 |
| 54 | Ga0466691_143158 | 3300042593 | Bacteria | 1719 |
| 55 | Ga0466699_203736 | 3300042597 | Bacteria | 11955 |
| 56 | Ga0466712_034448 | 3300042614 | Bacteria | 2921 |
| 57 | Ga0466712_100230 | 3300042614 | Bacteria | 3303 |
| 58 | Ga0466712_164241 | 3300042614 | Bacteria | 10083 |
| 59 | Ga0466711_010088 | 3300042615 | Bacteria | 1212 |
| 60 | Ga0466715_301192 | 3300042616 | Bacteria | 1004 |
| 61 | Ga0466718_075887 | 3300042617 | Bacteria | 2870 |
| 62 | Ga0466726_028772 | 3300042619 | Bacteria | 1786 |
| 63 | Ga0466726_059915 | 3300042619 | Bacteria | 1327 |
| 64 | Ga0466726_162207 | 3300042619 | Bacteria | 16385 |
| 65 | Ga0466726_167722 | 3300042619 | Unclassified | 1305 |
| 66 | Ga0466728_267668 | 3300042620 | Bacteria | 2567 |
| 67 | Ga0466729_156708 | 3300042621 | Bacteria | 1298 |
| 68 | Ga0466707_098355 | 3300042601 | Bacteria | 7832 |
| 69 | Ga0466707_155612 | 3300042601 | Bacteria | 1244 |
| 70 | Ga0466716_250989 | 3300042605 | Bacteria | 2156 |
| 71 | Ga0466719_062423 | 3300042606 | Bacteria | 2823 |
| 72 | Ga0466719_419977 | 3300042606 | Bacteria | 4449 |
| 73 | Ga0466722_194223 | 3300042609 | Bacteria | 2048 |
| 74 | Ga0123356_10025226 | 3300010049 | Bacteria | 5590 |
| 75 | Ga0123356_10112865 | 3300010049 | Unclassified | 2628 |
| 76 | Ga0123356_10759269 | 3300010049 | Bacteria | 1140 |
| 77 | Ga0466732_353891 | 3300042656 | Bacteria | 1397 |
| 78 | AustNasuHG_c1023332 | 3300000089 | Bacteria | 1976 |
| 79 | Ga0466729_252134 | 3300042621 | Bacteria | 1065 |
| 80 | Ga0466703_163641 | 3300042636 | Bacteria | 43980 |
| 81 | Ga0466704_099512 | 3300042643 | Bacteria | 2771 |
| 82 | Ga0466704_439445 | 3300042643 | Bacteria | 4901 |
| 83 | Ga0466704_477411 | 3300042643 | Bacteria | 12521 |
| 84 | Ga0466708_209123 | 3300042652 | Bacteria | 1516 |
| 85 | Ga0466708_276093 | 3300042652 | Bacteria | 7966 |
| 86 | Ga0264413_118799 | 3300024493 | Bacteria | 4008 |
| 87 | Ga0264413_125879 | 3300024493 | Unclassified | 3836 |
| 88 | Ga0466690_173752 | 3300042590 | Bacteria | 1062 |
| 89 | Ga0466694_266153 | 3300042594 | Bacteria | 1224 |
| 90 | Ga0466696_340966 | 3300042596 | Bacteria | 1141 |
| 91 | Ga0466699_139087 | 3300042597 | Bacteria | 1577 |
| 92 | Ga0466699_312176 | 3300042597 | Bacteria | 1170 |
| 93 | Ga0466712_013005 | 3300042614 | Bacteria | 1789 |
| 94 | Ga0466715_017433 | 3300042616 | Bacteria | 1184 |
| 95 | Ga0466715_074019 | 3300042616 | Bacteria | 13023 |
| 96 | Ga0466715_102437 | 3300042616 | Bacteria | 8834 |
| 97 | Ga0466715_206528 | 3300042616 | Bacteria | 2265 |
| 98 | Ga0466723_164956 | 3300042618 | Bacteria | 1471 |
| 99 | Ga0466726_190180 | 3300042619 | Bacteria | 1005 |
| 100 | Ga0466728_149331 | 3300042620 | Bacteria | 1562 |
| 101 | Ga0466706_222746 | 3300042599 | Bacteria | 1481 |
| 102 | Ga0466719_296191 | 3300042606 | Bacteria | 2567 |
| 103 | Ga0466720_020183 | 3300042607 | Unclassified | 3402 |
| 104 | Ga0466720_076677 | 3300042607 | Bacteria | 3153 |
| 105 | Ga0123356_10000325 | 3300010049 | Bacteria | 54913 |
| 106 | Ga0123356_10083660 | 3300010049 | Bacteria | 3023 |
| 107 | Ga0466705_142256 | 3300042612 | Bacteria | 2242 |
| 108 | AustNasuHG_c1005872 | 3300000089 | Bacteria | 4385 |
| 109 | AustNasuHG_c1006803 | 3300000089 | Bacteria | 4073 |
| 110 | AustNasuHG_c1016851 | 3300000089 | Bacteria | 2439 |
| 111 | JGI24698J34947_10056097 | 3300002449 | Bacteria | 1960 |
| 112 | JGI24698J34947_10148236 | 3300002449 | Bacteria | 978 |
| 113 | JGI24695J34938_10032535 | 3300002450 | Bacteria | 2408 |
| 114 | Ga0466727_082555 | 3300042655 | Bacteria | 5699 |
| 115 | Ga0264413_119714 | 3300024493 | Bacteria | 997 |
| 116 | Ga0466690_102641 | 3300042590 | Bacteria | 1091 |
| 117 | Ga0466690_361319 | 3300042590 | Bacteria | 2310 |
| 118 | Ga0466691_130897 | 3300042593 | Bacteria | 2890 |
| 119 | Ga0466691_144491 | 3300042593 | Bacteria | 2330 |
| 120 | Ga0466691_204945 | 3300042593 | Bacteria | 2020 |
| 121 | Ga0466699_376460 | 3300042597 | Bacteria | 1463 |
| 122 | Ga0466712_045680 | 3300042614 | Bacteria | 12340 |
| 123 | Ga0466711_098038 | 3300042615 | Bacteria | 22974 |
| 124 | Ga0466715_032197 | 3300042616 | Bacteria | 1174 |
| 125 | Ga0466726_475856 | 3300042619 | Bacteria | 1046 |
| 126 | Ga0466728_235458 | 3300042620 | Bacteria | 1539 |
| 127 | Ga0466707_250354 | 3300042601 | Bacteria | 1338 |
| 128 | Ga0466707_294377 | 3300042601 | Bacteria | 1252 |
| 129 | Ga0466720_011344 | 3300042607 | Bacteria | 20957 |
| 130 | Ga0466722_019953 | 3300042609 | Bacteria | 2394 |
| 131 | Ga0123356_11185426 | 3300010049 | Bacteria | 930 |
| 132 | Ga0123354_10368126 | 3300010882 | Bacteria | 1258 |
| 133 | Ga0466705_055556 | 3300042612 | Bacteria | 2036 |
| 134 | AustNasuHG_c1034226 | 3300000089 | Bacteria | 1365 |
| 135 | JGI24698J34947_10003946 | 3300002449 | Bacteria | 8066 |
| 136 | JGI24698J34947_10006176 | 3300002449 | Bacteria | 6580 |
| 137 | JGI24698J34947_10083548 | 3300002449 | Bacteria | 1490 |
| 138 | JGI24698J34947_10128581 | 3300002449 | Unclassified | 1087 |
| 139 | JGI24695J34938_10120462 | 3300002450 | Bacteria | 1068 |
| 140 | JGI24695J34938_10257701 | 3300002450 | Bacteria | 742 |
| 141 | Ga0466729_270963 | 3300042621 | Bacteria | 1222 |
| 142 | Ga0466704_117691 | 3300042643 | Bacteria | 1120 |
| 143 | Ga0466709_162543 | 3300042648 | Bacteria | 1164 |
| 144 | Ga0466709_188428 | 3300042648 | Bacteria | 1991 |
| 145 | Ga0466708_157961 | 3300042652 | Bacteria | 1756 |
| 146 | Ga0466727_082044 | 3300042655 | Archaea | 1160 |
| 147 | Ga0466690_111430 | 3300042590 | Bacteria | 2232 |
| 148 | Ga0466690_230498 | 3300042590 | Bacteria | 1950 |
| 149 | Ga0466690_316414 | 3300042590 | Bacteria | 8157 |
| 150 | Ga0466692_158242 | 3300042591 | Bacteria | 1726 |
| 151 | Ga0466691_101362 | 3300042593 | Bacteria | 1140 |
| 152 | Ga0466699_117897 | 3300042597 | Bacteria | 2137 |
| 153 | Ga0466712_030137 | 3300042614 | Bacteria | 4000 |
| 154 | Ga0466712_129269 | 3300042614 | Unclassified | 1359 |
| 155 | Ga0466711_102208 | 3300042615 | Bacteria | 3377 |
| 156 | Ga0466715_053009 | 3300042616 | Bacteria | 15489 |
| 157 | Ga0466718_080631 | 3300042617 | Bacteria | 14057 |
| 158 | Ga0466723_017759 | 3300042618 | Unclassified | 1406 |
| 159 | Ga0466726_041059 | 3300042619 | Bacteria | 1211 |
| 160 | Ga0466726_048926 | 3300042619 | Bacteria | 1118 |
| 161 | Ga0466726_127045 | 3300042619 | Bacteria | 1240 |
| 162 | Ga0466726_180960 | 3300042619 | Bacteria | 2112 |
| 163 | Ga0466726_357482 | 3300042619 | Bacteria | 1043 |
| 164 | Ga0466728_320268 | 3300042620 | Bacteria | 1834 |
| 165 | Ga0466728_429547 | 3300042620 | Bacteria | 1261 |
| 166 | Ga0466719_440894 | 3300042606 | Bacteria | 1534 |
| 167 | Ga0123355_10044873 | 3300009826 | Viruses | 7192 |
| 168 | Ga0466705_295698 | 3300042612 | Bacteria | 2502 |
| 169 | AustNasuHG_c1003396 | 3300000089 | Bacteria | 5750 |
| 170 | JGI24698J34947_10066227 | 3300002449 | Unclassified | 1758 |
| 171 | JGI24698J34947_10178080 | 3300002449 | Bacteria | 853 |
| 172 | JGI24698J34947_10193737 | 3300002449 | Bacteria | 802 |
| 173 | JGI24695J34938_10036226 | 3300002450 | Bacteria | 2251 |
| 174 | Ga0466729_272401 | 3300042621 | Bacteria | 1004 |
| 175 | Ga0466703_100078 | 3300042636 | Bacteria | 1900 |
| 176 | Ga0466704_080621 | 3300042643 | Bacteria | 4359 |
| 177 | Ga0466704_107143 | 3300042643 | Bacteria | 3917 |
| 178 | Ga0466704_226699 | 3300042643 | Bacteria | 2937 |
| 179 | Ga0466708_238960 | 3300042652 | Bacteria | 1267 |
| 180 | Ga0466727_094446 | 3300042655 | Bacteria | 1699 |
| 181 | Ga0466727_302428 | 3300042655 | Unclassified | 2890 |
| 182 | Ga0466692_034742 | 3300042591 | Bacteria | 4737 |
| 183 | Ga0466696_022561 | 3300042596 | Bacteria | 2619 |
| 184 | Ga0466696_128588 | 3300042596 | Bacteria | 2217 |
| 185 | Ga0466696_221207 | 3300042596 | Bacteria | 1457 |
| 186 | Ga0466696_269738 | 3300042596 | Bacteria | 1362 |
| 187 | Ga0466712_071653 | 3300042614 | Bacteria | 1810 |
| 188 | Ga0466712_104880 | 3300042614 | Bacteria | 22225 |
| 189 | Ga0466712_116618 | 3300042614 | Bacteria | 2195 |
| 190 | Ga0466712_133075 | 3300042614 | Bacteria | 6876 |
| 191 | Ga0466715_332409 | 3300042616 | Bacteria | 1467 |
| 192 | Ga0466718_027879 | 3300042617 | Unclassified | 1681 |
| 193 | Ga0466718_071455 | 3300042617 | Bacteria | 2413 |
| 194 | Ga0466718_091099 | 3300042617 | Bacteria | 2606 |
| 195 | Ga0466723_230539 | 3300042618 | Bacteria | 5400 |
| 196 | Ga0466726_013030 | 3300042619 | Bacteria | 1298 |
| 197 | Ga0466713_140190 | 3300042602 | Bacteria | 5180 |
| 198 | Ga0466716_352606 | 3300042605 | Bacteria | 3374 |
| 199 | Ga0466719_132152 | 3300042606 | Bacteria | 2463 |
| 200 | Ga0466720_068015 | 3300042607 | Bacteria | 2416 |
| 201 | Ga0466720_077927 | 3300042607 | Bacteria | 13582 |
| 202 | Ga0466720_114940 | 3300042607 | Bacteria | 2732 |
| 203 | Ga0123356_10051979 | 3300010049 | Unclassified | 3811 |
| 204 | Ga0466705_003254 | 3300042612 | Bacteria | 3261 |
| 205 | Ga0466705_029427 | 3300042612 | Bacteria | 4177 |
| 206 | Ga0466705_347717 | 3300042612 | Bacteria | 1494 |
| 207 | Ga0466733_111281 | 3300042659 | Bacteria | 2018 |
| 208 | JGI24698J34947_10009531 | 3300002449 | Bacteria | 5330 |
| 209 | JGI24698J34947_10072581 | 3300002449 | Bacteria | 1647 |
| 210 | JGI24695J34938_10033446 | 3300002450 | Bacteria | 2365 |
| 211 | JGI24697J35500_10767675 | 3300002507 | Bacteria | 687 |
| 212 | Ga0072940_1019437 | 3300005200 | Bacteria | 3843 |
| 213 | Ga0072941_1023554 | 3300005201 | Bacteria | 1572 |
| 214 | Ga0072941_1084462 | 3300005201 | Bacteria | 2513 |
| 215 | Ga0466729_248129 | 3300042621 | Bacteria | 1049 |
| 216 | Ga0466729_317030 | 3300042621 | Bacteria | 1018 |
| 217 | Ga0466704_253889 | 3300042643 | Bacteria | 6285 |
| 218 | Ga0466704_326758 | 3300042643 | Bacteria | 3414 |
| 219 | Ga0466704_348801 | 3300042643 | Bacteria | 47812 |
| 220 | Ga0466704_618173 | 3300042643 | Unclassified | 1283 |
| 221 | Ga0466727_172162 | 3300042655 | Bacteria | 1455 |
| 222 | Ga0466690_388553 | 3300042590 | Unclassified | 2013 |
| 223 | Ga0466690_400448 | 3300042590 | Bacteria | 1465 |
| 224 | Ga0466691_010830 | 3300042593 | Bacteria | 2294 |
| 225 | Ga0466699_011398 | 3300042597 | Bacteria | 5781 |
| 226 | Ga0466712_135311 | 3300042614 | Bacteria | 4116 |
| 227 | Ga0466711_151948 | 3300042615 | Bacteria | 12150 |
| 228 | Ga0466711_283164 | 3300042615 | Bacteria | 1797 |
| 229 | Ga0466715_068084 | 3300042616 | Bacteria | 1290 |
| 230 | Ga0466715_242939 | 3300042616 | Bacteria | 4557 |
| 231 | Ga0466715_402563 | 3300042616 | Bacteria | 6610 |
| 232 | Ga0466715_410014 | 3300042616 | Bacteria | 1180 |
| 233 | Ga0466723_039355 | 3300042618 | Bacteria | 4269 |
| 234 | Ga0466726_270213 | 3300042619 | Bacteria | 1217 |
| 235 | Ga0466726_426466 | 3300042619 | Bacteria | 2421 |
| 236 | Ga0466729_006291 | 3300042621 | Bacteria | 1338 |
| 237 | Ga0466707_346962 | 3300042601 | Bacteria | 2401 |
| 238 | Ga0466717_219355 | 3300042604 | Bacteria | 1718 |
| 239 | Ga0466720_180643 | 3300042607 | Bacteria | 1074 |
| 240 | Ga0123356_10080650 | 3300010049 | Bacteria | 3077 |
| 241 | Ga0123356_10937019 | 3300010049 | Bacteria | 1037 |
| 242 | Ga0466705_271471 | 3300042612 | Bacteria | 1092 |
| 243 | AustNasuHG_c1014861 | 3300000089 | Bacteria | 2637 |
| 244 | JGI24698J34947_10003644 | 3300002449 | Bacteria | 8367 |
| 245 | JGI24698J34947_10023672 | 3300002449 | Bacteria | 3285 |
| 246 | JGI24698J34947_10035299 | 3300002449 | Unclassified | 2611 |
| 247 | JGI24698J34947_10134448 | 3300002449 | Bacteria | 1052 |
| 248 | JGI24695J34938_10000912 | 3300002450 | Bacteria | 27225 |
| 249 | Ga0068305_10015397 | 3300005083 | Bacteria | 5004 |
| 250 | Ga0074263_126132 | 3300005485 | Bacteria | 834 |
| 251 | Ga0466703_125117 | 3300042636 | Bacteria | 1784 |
| 252 | Ga0466704_019824 | 3300042643 | Bacteria | 3000 |
| 253 | Ga0466709_003474 | 3300042648 | Bacteria | 4043 |
| 254 | Ga0466708_319828 | 3300042652 | Bacteria | 1739 |
| 255 | Ga0466708_341993 | 3300042652 | Bacteria | 1078 |
| 256 | Ga0466708_365217 | 3300042652 | Bacteria | 3210 |
| 257 | Ga0466727_187063 | 3300042655 | Bacteria | 1200 |
| 258 | Ga0466727_261530 | 3300042655 | Bacteria | 1777 |
| 259 | Ga0466727_341216 | 3300042655 | Bacteria | 1036 |
| 260 | Ga0264413_126181 | 3300024493 | Archaea | 2058 |
| 261 | Ga0466692_047597 | 3300042591 | Bacteria | 10515 |
| 262 | Ga0466692_181683 | 3300042591 | Bacteria | 1062 |
| 263 | Ga0466691_069471 | 3300042593 | Bacteria | 1660 |
| 264 | Ga0466696_287580 | 3300042596 | Bacteria | 1079 |
| 265 | Ga0466718_150465 | 3300042617 | Unclassified | 31408 |
| 266 | Ga0466723_009921 | 3300042618 | Bacteria | 1334 |
| 267 | Ga0466726_231865 | 3300042619 | Bacteria | 1089 |
| 268 | Ga0466726_282175 | 3300042619 | Bacteria | 1048 |
| 269 | Ga0466728_282443 | 3300042620 | Bacteria | 4258 |
| 270 | Ga0466707_154557 | 3300042601 | Bacteria | 3881 |
| 271 | Ga0466713_099239 | 3300042602 | Bacteria | 1119 |
| 272 | Ga0466719_046006 | 3300042606 | Bacteria | 5349 |
| 273 | Ga0466722_144395 | 3300042609 | Bacteria | 1209 |
| 274 | Ga0466698_006762 | 3300042610 | Bacteria | 2166 |
| 275 | Ga0123356_10019285 | 3300010049 | Bacteria | 6466 |
| 276 | Ga0123356_10265394 | 3300010049 | Bacteria | 1803 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.