Protein Family IF06678

Metagenome Isolate
207 Members
65 Samples
182 Scaffolds
801.19 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_170813|Ga0466720_170813_1369_4032
Length
887 aa
Sequence
MSYYKTGYVDPVDDIGALLLEVDKPGRYCGGEYGRLAKKDASLQALIAFPDLYELGMSNQALRIIYNRLNRMFDISCDRAFAPAPDFERLLREKRLPLYGLDTGISLKRLDLLLFTLGYELGITGILTMLDVSGIPLRCDQRGGEDPLVIAGGPAVSNPLPYSAFIDAFWIGEAEAGFFDLVQELLEIKRGGGSRSTLFDRLKEHPNIFVRGKEKAFRAVDACFATRDASNEGAPSVYPVPSMKTVQHHGLLEIMRGCPNGCRFCHAGYWYRPMRQKKPETIIREAEAFVTLGGYREISLSSLSSGDYSGIGDLVDALNDQFSGRHISFQMPSLKVSTFALSLLEKISQTRKSGLTFAVETPLDFWQLAINKQVTENYVVEIIREAKRNGWRGAKFYFMIGLPACSQASTVDSADTAKDIVVSSSAGEETEIVNFVSSVAKKTAMHFNINVGIFVPKPHTPYQWARQLDSETAAKKLDFIRSKLKPQGHKVSVCDPFVSMLEGILSRGDERAGGLIEQAFRLGTRLDPWQEFISKEAWQTVLEQNPGLADEFLMVKDPSVPLPWSVINADVSPAYLRKELEKSNRGELTPPCAEDCASRCGVCNEQLAVKWGQGTGNXXXXFGTKALRVLQLSPQGVEPEVRGSHLAVKHAQITNQSSVSSPQSLVPSLAKKPDPVIWRLLFSFSKEGSAVFHGHLSLVEIFSMALCRTGLDVRYTQGFNPLAKLEIVSPLSVGISAGGEVAAVEFLHAVQPSEFLEKMNATLPEGLIITQADCYCIPSGSKKHSLSSLLWGFGYLGPDSETIYVPAAAEKALREKHLSSGQILFSIRRSCVLAKNLIDGGQAGGNAQPWASYFDIYGHLYGSRDWGLGLLEVPQSLNRDNTYYKSE

📊 Sample Types

Isolate 12.1%
Metagenome 87.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 39.7%
Termitidae 30.2%
Kalotermitidae 22.2%
Rhinotermitidae 4.8%
Termopsidae 3.2%

🌳 Taxonomy

Archaea 0
Bacteria 200
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
2 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
3 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
7 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
8 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
19 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
20 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
21 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
22 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
23 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
24 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
25 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
26 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
37 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
43 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
44 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
45 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
48 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
49 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
50 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
51 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
52 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
53 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
54 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
55 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
56 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
57 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
58 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
59 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
60 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
61 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
62 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
63 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
64 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
65 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10000141 3300010049 Bacteria 81679
2 Ga0264413_106755 3300024493 Bacteria 25715
3 Ga0264413_126179 3300024493 Bacteria 2735
4 Ga0415639_003622 3300038395 Bacteria 12682
5 Ga0415639_024631 3300038395 Bacteria 7070
6 Ga0466690_002923 3300042590 Bacteria 3265
7 Ga0466690_026400 3300042590 Bacteria 3205
8 Ga0466692_028407 3300042591 Bacteria 5294
9 Ga0466696_222736 3300042596 Bacteria 13698
10 Ga0466699_045947 3300042597 Bacteria 18961
11 Ga0466712_037672 3300042614 Bacteria 53460
12 Ga0466702_338329 3300042635 Bacteria 6830
13 Ga0466709_294431 3300042648 Bacteria 58398
14 Ga0466708_098963 3300042652 Unclassified 2362
15 AustNasuHG_c1009736 3300000089 Bacteria 3367
16 JGI24698J34947_10000746 3300002449 Bacteria 16021
17 JGI24695J34938_10000571 3300002450 Bacteria 35414
18 JGI24695J34938_10000757 3300002450 Bacteria 30318
19 JGI24695J34938_10002017 3300002450 Bacteria 16100
20 JGI24695J34938_10003052 3300002450 Bacteria 11995
21 Ga0072941_1031878 3300005201 Bacteria 7245
22 Ga0466693_351063 3300042592 Bacteria 21220
23 Ga0466691_047974 3300042593 Bacteria 32019
24 Ga0466694_108083 3300042594 Bacteria 54973
25 Ga0466699_076425 3300042597 Bacteria 21448
26 Ga0466699_095068 3300042597 Bacteria 13056
27 Ga0466699_100855 3300042597 Bacteria 53915
28 Ga0466699_172432 3300042597 Bacteria 52995
29 Ga0466699_443293 3300042597 Bacteria 6195
30 Ga0466712_079374 3300042614 Bacteria 13725
31 Ga0466712_086852 3300042614 Bacteria 7354
32 Ga0466712_147746 3300042614 Bacteria 27283
33 Ga0466711_509972 3300042615 Bacteria 3384
34 Ga0466715_054394 3300042616 Bacteria 16575
35 Ga0466718_070724 3300042617 Bacteria 4885
36 Ga0466723_097732 3300042618 Bacteria 2555
37 Ga0466723_163983 3300042618 Bacteria 17494
38 Ga0466726_442981 3300042619 Unclassified 2374
39 Ga0466716_333764 3300042605 Bacteria 15994
40 Ga0466720_044234 3300042607 Bacteria 4547
41 Ga0466720_071404 3300042607 Bacteria 11024
42 Ga0466720_170813 3300042607 Bacteria 7806
43 Ga0466722_172966 3300042609 Bacteria 19370
44 Ga0466722_213738 3300042609 Bacteria 8111
45 Ga0466703_128607 3300042636 Bacteria 16421
46 Ga0466709_190598 3300042648 Bacteria 8311
47 AustNasuHG_c1001036 3300000089 Bacteria 10004
48 AustNasuHG_c1006605 3300000089 Bacteria 4133
49 JGI24698J34947_10005800 3300002449 Bacteria 6770
50 JGI24698J34947_10020497 3300002449 Bacteria 3559
51 JGI24695J34938_10000093 3300002450 Bacteria 78486
52 JGI24695J34938_10005798 3300002450 Bacteria 7598
53 JGI24695J34938_10018547 3300002450 Bacteria 3473
54 Ga0072941_1093923 3300005201 Bacteria 4490
55 Ga0456237_0001185 3300041968 Bacteria 4121
56 Ga0466690_188544 3300042590 Bacteria 16088
57 Ga0466694_111130 3300042594 Bacteria 20009
58 Ga0466694_248851 3300042594 Bacteria 15559
59 Ga0466696_078227 3300042596 Bacteria 8588
60 Ga0466699_387620 3300042597 Bacteria 3195
61 Ga0466712_205212 3300042614 Bacteria 7522
62 Ga0466718_147821 3300042617 Bacteria 51565
63 Ga0466728_165754 3300042620 Bacteria 10884
64 Ga0466719_298097 3300042606 Bacteria 9129
65 Ga0466720_211375 3300042607 Bacteria 60841
66 Ga0466722_031100 3300042609 Bacteria 10578
67 Ga0466722_192961 3300042609 Bacteria 7261
68 Ga0466698_363296 3300042610 Bacteria 21780
69 JGI24698J34947_10004899 3300002449 Unclassified 7335
70 JGI24698J34947_10020224 3300002449 Bacteria 3588
71 Ga0466705_375479 3300042612 Bacteria 4752
72 Ga0466732_135013 3300042656 Bacteria 23017
73 Ga0123355_10050925 3300009826 Unclassified 6724
74 Ga0123356_10000086 3300010049 Bacteria 97047
75 Ga0123356_10000124 3300010049 Bacteria 85126
76 Ga0123356_10000198 3300010049 Bacteria 69577
77 Ga0123356_10000550 3300010049 Bacteria 41544
78 Ga0123356_10005719 3300010049 Bacteria 12632
79 Ga0123356_10053274 3300010049 Bacteria 3765
80 Ga0466690_278794 3300042590 Bacteria 28190
81 Ga0466694_252444 3300042594 Bacteria 2686
82 Ga0466699_025262 3300042597 Bacteria 91867
83 Ga0466718_022853 3300042617 Bacteria 49734
84 Ga0466718_065586 3300042617 Bacteria 10063
85 Ga0466723_183751 3300042618 Bacteria 6228
86 Ga0466719_551309 3300042606 Unclassified 3795
87 Ga0466720_092177 3300042607 Bacteria 42147
88 Ga0466698_270225 3300042610 Bacteria 4250
89 Ga0466735_014885 3300042624 Bacteria 6988
90 Ga0466702_266794 3300042635 Bacteria 8003
91 JGI24698J34947_10002511 3300002449 Bacteria 9900
92 JGI24698J34947_10007574 3300002449 Bacteria 5964
93 JGI24695J34938_10000009 3300002450 Bacteria 135235
94 JGI24695J34938_10001122 3300002450 Bacteria 24061
95 JGI24695J34938_10007349 3300002450 Bacteria 6470
96 Ga0074263_111606 3300005485 Bacteria 3138
97 Ga0466705_183474 3300042612 Bacteria 93595
98 Ga0264413_105860 3300024493 Bacteria 17083
99 Ga0466692_181611 3300042591 Bacteria 5858
100 Ga0466693_437327 3300042592 Bacteria 95896
101 Ga0466691_177563 3300042593 Bacteria 51941
102 Ga0466694_162089 3300042594 Bacteria 14804
103 Ga0466699_436179 3300042597 Bacteria 3378
104 Ga0466712_143047 3300042614 Bacteria 10724
105 Ga0466715_428670 3300042616 Bacteria 32474
106 Ga0466718_038565 3300042617 Bacteria 4527
107 Ga0466723_373294 3300042618 Bacteria 21747
108 Ga0466720_018686 3300042607 Bacteria 82484
109 Ga0466720_049593 3300042607 Bacteria 16560
110 Ga0466720_191977 3300042607 Bacteria 68744
111 Ga0466722_204047 3300042609 Bacteria 6147
112 Ga0466704_024418 3300042643 Bacteria 19237
113 Ga0466708_125348 3300042652 Bacteria 9470
114 Ga0466708_235833 3300042652 Bacteria 24736
115 AustNasuHG_c1005924 3300000089 Bacteria 4369
116 JGI24698J34947_10000438 3300002449 Bacteria 19219
117 JGI24698J34947_10012138 3300002449 Bacteria 4728
118 JGI24695J34938_10000322 3300002450 Bacteria 47194
119 JGI24695J34938_10001064 3300002450 Bacteria 24848
120 JGI24702J35022_10001743 3300002462 Unclassified 13485
121 Ga0072941_1004754 3300005201 Bacteria 11996
122 Ga0072941_1008631 3300005201 Bacteria 10301
123 Ga0072941_1058090 3300005201 Bacteria 2736
124 Ga0123356_10000286 3300010049 Bacteria 58205
125 Ga0123356_10000496 3300010049 Bacteria 43882
126 Ga0466690_057140 3300042590 Bacteria 30420
127 Ga0466694_164669 3300042594 Bacteria 43666
128 Ga0466699_183021 3300042597 Bacteria 12859
129 Ga0466712_043490 3300042614 Bacteria 2905
130 Ga0466728_022704 3300042620 Bacteria 19629
131 Ga0466728_035528 3300042620 Bacteria 20281
132 Ga0466720_226563 3300042607 Bacteria 20897
133 Ga0466721_137114 3300042608 Bacteria 43430
134 Ga0466703_091943 3300042636 Bacteria 3452
135 JGI24695J34938_10000184 3300002450 Bacteria 58384
136 Ga0072941_1000053 3300005201 Bacteria 29032
137 Ga0123356_10054097 3300010049 Bacteria 3738
138 Ga0466690_213820 3300042590 Bacteria 3813
139 Ga0466694_242072 3300042594 Bacteria 48328
140 Ga0466712_038019 3300042614 Bacteria 2812
141 Ga0466712_068156 3300042614 Bacteria 24776
142 Ga0466718_042837 3300042617 Bacteria 5223
143 Ga0466722_074173 3300042609 Bacteria 6630
144 Ga0466722_087807 3300042609 Bacteria 3962
145 Ga0466722_250381 3300042609 Bacteria 28643
146 Ga0466703_084950 3300042636 Bacteria 6390
147 JGI24698J34947_10004529 3300002449 Bacteria 7568
148 JGI24695J34938_10000167 3300002450 Bacteria 61547
149 JGI24695J34938_10000311 3300002450 Bacteria 48045
150 JGI24695J34938_10000461 3300002450 Bacteria 39539
151 JGI24695J34938_10000712 3300002450 Bacteria 31375
152 JGI24695J34938_10001470 3300002450 Bacteria 19912
153 JGI24695J34938_10003013 3300002450 Bacteria 12111
154 JGI24702J35022_10021225 3300002462 Bacteria 3523
155 Ga0466705_094958 3300042612 Bacteria 18504
156 Ga0466732_052875 3300042656 Bacteria 6053
157 Ga0466732_113403 3300042656 Bacteria 45301
158 Ga0123356_10006696 3300010049 Bacteria 11605
159 Ga0264413_100040 3300024493 Bacteria 17360
160 Ga0264413_116865 3300024493 Unclassified 10570
161 Ga0466693_418271 3300042592 Bacteria 5450
162 Ga0466695_269929 3300042595 Bacteria 31150
163 Ga0466696_439135 3300042596 Bacteria 3720
164 Ga0466712_019453 3300042614 Bacteria 25512
165 Ga0466712_051991 3300042614 Bacteria 23670
166 Ga0466712_063834 3300042614 Bacteria 19365
167 Ga0466712_105292 3300042614 Bacteria 27417
168 Ga0466712_119968 3300042614 Bacteria 38238
169 Ga0466712_147988 3300042614 Bacteria 13258
170 Ga0466718_076035 3300042617 Bacteria 62220
171 Ga0466718_085903 3300042617 Bacteria 3858
172 Ga0466723_201346 3300042618 Bacteria 4748
173 Ga0466719_365881 3300042606 Bacteria 27169
174 Ga0466720_001724 3300042607 Bacteria 3644
175 Ga0466722_175249 3300042609 Bacteria 63620
176 Ga0466708_143836 3300042652 Bacteria 29622
177 JGI24698J34947_10000119 3300002449 Bacteria 27943
178 JGI24698J34947_10004838 3300002449 Bacteria 7372
179 JGI24698J34947_10008317 3300002449 Bacteria 5690
180 JGI24695J34938_10000015 3300002450 Bacteria 118711
181 JGI24695J34938_10000280 3300002450 Bacteria 50115
182 Ga0072941_1074547 3300005201 Bacteria 8607

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19864 Radical_SAM_N2 Radical SAM proteins, N-terminal 62 210 0.99
PF04055 Radical_SAM Radical SAM superfamily 253 403 0.95
PF10105 DUF2344 Uncharacterized protein conserved in bacteria (DUF2344) 679 774 0.89

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.