Protein Family IF06669
Metagenome
Isolate
109
Members
45
Samples
106
Scaffolds
236.7
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_144090|Ga0466720_144090_1582_2400
- Length
- 272 aa
- Sequence
- LSYRHCVAVAFDIHKRRYRRFNKELKMALTDKIEIPRRTMVLFFVIDTSGSMDGSKIGAVNTAIEEVIPAIKEVSDENADAQIKIAALEFSSGARWITTSGPVEVDQFRWNYLDAAGVTEFGAACKTLNDKLSTKAFMQEATGSFAPAIFLLSDGEPTDDNWAGELARLKQNNWFKAAVKVAIAIGDDANKDVLKEFTGSMEAVLETHNAATLKKMIKFVSVRASQVASKSSNVNDTAADLGDEQKQEELNANLQEFTQEIAAAPDNDQEDW
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.5%
Kalotermitidae
30.2%
Unclassified
11.6%
Rhinotermitidae
9.3%
Termopsidae
7.0%
Hodotermitidae
2.3%
Taxonomy
Archaea
1
Bacteria
96
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 3 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 6 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 11 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 12 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 13 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10000459 | 3300002450 | Bacteria | 39605 |
| 2 | Ga0466712_086888 | 3300042614 | Bacteria | 2804 |
| 3 | Ga0466718_106335 | 3300042617 | Bacteria | 2077 |
| 4 | Ga0466726_216454 | 3300042619 | Bacteria | 3996 |
| 5 | Ga0466729_302663 | 3300042621 | Bacteria | 6306 |
| 6 | Ga0466727_168282 | 3300042655 | Bacteria | 1111 |
| 7 | Ga0415639_133990 | 3300038395 | Bacteria | 8877 |
| 8 | Ga0466691_093291 | 3300042593 | Bacteria | 5894 |
| 9 | Ga0466696_049467 | 3300042596 | Bacteria | 1565 |
| 10 | Ga0466696_309710 | 3300042596 | Bacteria | 3176 |
| 11 | Ga0466706_272131 | 3300042599 | Unclassified | 20286 |
| 12 | Ga0466717_239220 | 3300042604 | Unclassified | 1061 |
| 13 | AustNasuHG_c1004704 | 3300000089 | Bacteria | 4895 |
| 14 | JGI24698J34947_10045373 | 3300002449 | Bacteria | 2244 |
| 15 | Ga0466718_007335 | 3300042617 | Bacteria | 19334 |
| 16 | Ga0466723_012828 | 3300042618 | Bacteria | 59362 |
| 17 | Ga0466726_482236 | 3300042619 | Bacteria | 2223 |
| 18 | Ga0466727_070885 | 3300042655 | Bacteria | 1002 |
| 19 | Ga0466727_215780 | 3300042655 | Bacteria | 1097 |
| 20 | Ga0466727_259672 | 3300042655 | Unclassified | 3626 |
| 21 | Ga0264413_106202 | 3300024493 | Bacteria | 3775 |
| 22 | Ga0466716_298092 | 3300042605 | Bacteria | 3296 |
| 23 | Ga0466705_003958 | 3300042612 | Bacteria | 3579 |
| 24 | Ga0466705_373706 | 3300042612 | Bacteria | 1560 |
| 25 | AustNasuHG_c1002138 | 3300000089 | Bacteria | 7140 |
| 26 | AustNasuHG_c1002643 | 3300000089 | Bacteria | 6470 |
| 27 | Ga0072940_1128181 | 3300005200 | Bacteria | 3169 |
| 28 | Ga0072941_1032142 | 3300005201 | Unclassified | 22163 |
| 29 | Ga0466703_416497 | 3300042636 | Bacteria | 1495 |
| 30 | Ga0264413_112181 | 3300024493 | Unclassified | 2771 |
| 31 | Ga0466707_031989 | 3300042601 | Bacteria | 2162 |
| 32 | Ga0466719_542558 | 3300042606 | Bacteria | 4243 |
| 33 | Ga0466722_131663 | 3300042609 | Bacteria | 7085 |
| 34 | Ga0123353_10004428 | 3300010167 | Bacteria | 18088 |
| 35 | Ga0466732_071629 | 3300042656 | Bacteria | 2343 |
| 36 | JGI24698J34947_10002995 | 3300002449 | Bacteria | 9160 |
| 37 | Ga0466711_207592 | 3300042615 | Bacteria | 10988 |
| 38 | Ga0466715_534119 | 3300042616 | Bacteria | 1547 |
| 39 | Ga0466718_078346 | 3300042617 | Unclassified | 1473 |
| 40 | Ga0466726_224556 | 3300042619 | Bacteria | 1030 |
| 41 | Ga0466728_024081 | 3300042620 | Bacteria | 2408 |
| 42 | Ga0466702_227066 | 3300042635 | Unclassified | 10597 |
| 43 | Ga0466703_017254 | 3300042636 | Bacteria | 4594 |
| 44 | Ga0456237_0004027 | 3300041968 | Bacteria | 2365 |
| 45 | Ga0466692_141768 | 3300042591 | Bacteria | 1607 |
| 46 | Ga0466706_131972 | 3300042599 | Bacteria | 5677 |
| 47 | Ga0466716_067674 | 3300042605 | Bacteria | 13651 |
| 48 | Ga0466719_398639 | 3300042606 | Bacteria | 10758 |
| 49 | Ga0466719_475721 | 3300042606 | Bacteria | 2258 |
| 50 | Ga0466720_144090 | 3300042607 | Bacteria | 3298 |
| 51 | Ga0466705_389511 | 3300042612 | Unclassified | 10262 |
| 52 | Ga0466712_014363 | 3300042614 | Bacteria | 10544 |
| 53 | Ga0466715_034937 | 3300042616 | Bacteria | 8335 |
| 54 | Ga0466718_084033 | 3300042617 | Bacteria | 13040 |
| 55 | Ga0466726_061223 | 3300042619 | Bacteria | 13569 |
| 56 | Ga0466728_148814 | 3300042620 | Bacteria | 9342 |
| 57 | Ga0466728_386816 | 3300042620 | Bacteria | 3511 |
| 58 | Ga0466708_261703 | 3300042652 | Bacteria | 2822 |
| 59 | Ga0264413_128451 | 3300024493 | Unclassified | 10171 |
| 60 | Ga0466699_340925 | 3300042597 | Bacteria | 1404 |
| 61 | Ga0466707_229224 | 3300042601 | Bacteria | 2589 |
| 62 | Ga0466707_420731 | 3300042601 | Bacteria | 1105 |
| 63 | Ga0466719_339087 | 3300042606 | Bacteria | 2468 |
| 64 | Ga0466720_145827 | 3300042607 | Bacteria | 17462 |
| 65 | Ga0466705_266252 | 3300042612 | Bacteria | 4189 |
| 66 | Ga0466718_065675 | 3300042617 | Bacteria | 12540 |
| 67 | Ga0466704_593500 | 3300042643 | Archaea | 2317 |
| 68 | Ga0466727_188533 | 3300042655 | Bacteria | 3164 |
| 69 | Ga0466694_044251 | 3300042594 | Bacteria | 9678 |
| 70 | Ga0466707_063887 | 3300042601 | Bacteria | 2101 |
| 71 | Ga0466720_040715 | 3300042607 | Bacteria | 23537 |
| 72 | Ga0123356_10344137 | 3300010049 | Bacteria | 1613 |
| 73 | Ga0466705_192355 | 3300042612 | Bacteria | 1892 |
| 74 | AustNasuHG_c1008811 | 3300000089 | Bacteria | 3568 |
| 75 | AustNasuHG_c1020714 | 3300000089 | Bacteria | 2138 |
| 76 | Ga0068305_10022004 | 3300005083 | Bacteria | 4919 |
| 77 | Ga0074263_106212 | 3300005485 | Bacteria | 1466 |
| 78 | Ga0466726_122066 | 3300042619 | Bacteria | 1151 |
| 79 | Ga0466726_381195 | 3300042619 | Bacteria | 1897 |
| 80 | Ga0466704_198749 | 3300042643 | Bacteria | 18695 |
| 81 | Ga0466727_292736 | 3300042655 | Bacteria | 11886 |
| 82 | Ga0264413_105292 | 3300024493 | Bacteria | 6616 |
| 83 | Ga0264413_137468 | 3300024493 | Bacteria | 1867 |
| 84 | Ga0466690_051927 | 3300042590 | Bacteria | 1733 |
| 85 | Ga0466692_045777 | 3300042591 | Bacteria | 14960 |
| 86 | Ga0466691_030960 | 3300042593 | Bacteria | 3030 |
| 87 | Ga0466707_088677 | 3300042601 | Bacteria | 1617 |
| 88 | Ga0466719_143465 | 3300042606 | Bacteria | 1901 |
| 89 | Ga0466720_086704 | 3300042607 | Unclassified | 2613 |
| 90 | Ga0466720_158750 | 3300042607 | Bacteria | 12292 |
| 91 | Ga0123353_10086588 | 3300010167 | Bacteria | 5046 |
| 92 | Ga0466732_173604 | 3300042656 | Bacteria | 6470 |
| 93 | Ga0466732_248572 | 3300042656 | Bacteria | 6721 |
| 94 | JGI24695J34938_10005626 | 3300002450 | Bacteria | 7757 |
| 95 | JGI24702J35022_10105474 | 3300002462 | Bacteria | 1546 |
| 96 | Ga0074263_108122 | 3300005485 | Bacteria | 1533 |
| 97 | Ga0466726_126522 | 3300042619 | Bacteria | 3894 |
| 98 | Ga0466735_040585 | 3300042624 | Bacteria | 2567 |
| 99 | Ga0466704_120816 | 3300042643 | Bacteria | 4711 |
| 100 | Ga0466704_371051 | 3300042643 | Unclassified | 2686 |
| 101 | Ga0264413_133994 | 3300024493 | Bacteria | 7387 |
| 102 | Ga0466696_065652 | 3300042596 | Bacteria | 2177 |
| 103 | Ga0466716_216427 | 3300042605 | Bacteria | 4194 |
| 104 | Ga0466719_321792 | 3300042606 | Bacteria | 13838 |
| 105 | Ga0466720_084993 | 3300042607 | Unclassified | 3179 |
| 106 | Ga0123356_10954742 | 3300010049 | Bacteria | 1028 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00092 | VWA | von Willebrand factor type A domain | 42 | 215 | 0.75 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.