Protein Family IF06668
Metagenome
Isolate
179
Members
42
Samples
175
Scaffolds
280.49
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_141815|Ga0466720_141815_10921_11775
- Length
- 284 aa
- Sequence
- MKKLPGSLIPMYLFTLAFVFGPLVYMAALSFMRRRGVWDVEAVFTLRNYRLILEPVYMETFKQSVKLALVSTLTVTLMGYPFGYFMARLSPIWRGRVMLLLIIPFWTSALMRLYGWIIVFRSNGVLDRLLASLLMRFGLRHEPLRLLYSYPAVVTGMIYALLPFMIYSVYASAEKMDRSLVEAARVLGAGRLRAFLTVTLPLTMPGLFSGVILTFIPSMGLYFIADILGGNKVVLVGNLIREQVMNVHNLPFAAALSVTLMALTSLFLYLYRLAARTNEIEGLI
Sample Types
Isolate
2.2%
Metagenome
97.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.1%
Kalotermitidae
34.1%
Unclassified
12.2%
Rhinotermitidae
9.8%
Termopsidae
7.3%
Hodotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
169
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 7 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_378446 | 3300042590 | Unclassified | 1465 |
| 2 | Ga0466692_029729 | 3300042591 | Bacteria | 7707 |
| 3 | Ga0466696_322632 | 3300042596 | Bacteria | 5248 |
| 4 | Ga0466696_367318 | 3300042596 | Bacteria | 4158 |
| 5 | Ga0466706_151292 | 3300042599 | Bacteria | 4288 |
| 6 | Ga0466700_057547 | 3300042600 | Bacteria | 1953 |
| 7 | Ga0466712_100249 | 3300042614 | Unclassified | 9154 |
| 8 | Ga0466711_159840 | 3300042615 | Bacteria | 4950 |
| 9 | Ga0466711_191871 | 3300042615 | Bacteria | 10434 |
| 10 | Ga0466715_072901 | 3300042616 | Unclassified | 2187 |
| 11 | Ga0466715_238104 | 3300042616 | Bacteria | 5282 |
| 12 | Ga0466715_359500 | 3300042616 | Bacteria | 12009 |
| 13 | Ga0466718_018845 | 3300042617 | Bacteria | 1523 |
| 14 | Ga0466718_079910 | 3300042617 | Bacteria | 1774 |
| 15 | Ga0074263_112119 | 3300005485 | Bacteria | 1562 |
| 16 | Ga0466704_020506 | 3300042643 | Bacteria | 4223 |
| 17 | Ga0466704_430130 | 3300042643 | Bacteria | 11905 |
| 18 | Ga0466709_355921 | 3300042648 | Unclassified | 1540 |
| 19 | Ga0466708_109289 | 3300042652 | Bacteria | 11340 |
| 20 | Ga0466708_288471 | 3300042652 | Bacteria | 4417 |
| 21 | Ga0466705_332532 | 3300042612 | Bacteria | 16839 |
| 22 | Ga0466733_032415 | 3300042659 | Bacteria | 3861 |
| 23 | Ga0123353_10702008 | 3300010167 | Bacteria | 1419 |
| 24 | Ga0466690_182278 | 3300042590 | Bacteria | 2713 |
| 25 | Ga0466696_300163 | 3300042596 | Bacteria | 19461 |
| 26 | Ga0466699_254676 | 3300042597 | Bacteria | 1184 |
| 27 | Ga0466719_100976 | 3300042606 | Bacteria | 6353 |
| 28 | Ga0466720_002982 | 3300042607 | Bacteria | 1510 |
| 29 | Ga0466720_003065 | 3300042607 | Bacteria | 3944 |
| 30 | Ga0466720_029645 | 3300042607 | Bacteria | 14950 |
| 31 | Ga0466720_105885 | 3300042607 | Bacteria | 2305 |
| 32 | Ga0466720_192931 | 3300042607 | Bacteria | 5580 |
| 33 | Ga0466711_006716 | 3300042615 | Bacteria | 1469 |
| 34 | Ga0466711_449900 | 3300042615 | Bacteria | 3384 |
| 35 | Ga0466715_504635 | 3300042616 | Bacteria | 3589 |
| 36 | Ga0466723_193082 | 3300042618 | Bacteria | 7715 |
| 37 | Ga0466726_134893 | 3300042619 | Bacteria | 1300 |
| 38 | Ga0466726_425761 | 3300042619 | Bacteria | 1641 |
| 39 | Ga0466729_097768 | 3300042621 | Bacteria | 2557 |
| 40 | Ga0466704_254552 | 3300042643 | Bacteria | 3414 |
| 41 | Ga0466709_046874 | 3300042648 | Bacteria | 14776 |
| 42 | Ga0466708_136585 | 3300042652 | Bacteria | 9440 |
| 43 | Ga0466708_168294 | 3300042652 | Bacteria | 3321 |
| 44 | Ga0466727_182935 | 3300042655 | Bacteria | 1213 |
| 45 | Ga0466727_257490 | 3300042655 | Bacteria | 2375 |
| 46 | Ga0466705_151743 | 3300042612 | Unclassified | 1549 |
| 47 | Ga0123353_10085114 | 3300010167 | Bacteria | 5091 |
| 48 | Ga0466707_049873 | 3300042601 | Bacteria | 6934 |
| 49 | Ga0466707_068639 | 3300042601 | Bacteria | 42326 |
| 50 | Ga0466707_180120 | 3300042601 | Bacteria | 2550 |
| 51 | Ga0466711_273907 | 3300042615 | Bacteria | 17159 |
| 52 | Ga0466711_509476 | 3300042615 | Bacteria | 8817 |
| 53 | Ga0466715_027602 | 3300042616 | Bacteria | 4599 |
| 54 | Ga0466715_609346 | 3300042616 | Bacteria | 16085 |
| 55 | Ga0466718_161880 | 3300042617 | Bacteria | 10061 |
| 56 | Ga0466723_165480 | 3300042618 | Bacteria | 2730 |
| 57 | Ga0466723_249468 | 3300042618 | Unclassified | 5779 |
| 58 | Ga0466726_297185 | 3300042619 | Bacteria | 3270 |
| 59 | Ga0466729_158243 | 3300042621 | Bacteria | 1033 |
| 60 | Nasutiter_Contig42652 | 2030936001 | Bacteria | 766 |
| 61 | Ga0466735_229151 | 3300042624 | Bacteria | 2082 |
| 62 | Ga0466703_054627 | 3300042636 | Bacteria | 12869 |
| 63 | Ga0466708_134917 | 3300042652 | Bacteria | 4182 |
| 64 | Ga0466708_233874 | 3300042652 | Bacteria | 2778 |
| 65 | Ga0466705_117515 | 3300042612 | Bacteria | 18432 |
| 66 | Ga0466705_304392 | 3300042612 | Bacteria | 4817 |
| 67 | Ga0466691_207322 | 3300042593 | Bacteria | 3164 |
| 68 | Ga0466707_401579 | 3300042601 | Bacteria | 1964 |
| 69 | Ga0466716_141327 | 3300042605 | Bacteria | 3354 |
| 70 | Ga0466716_361827 | 3300042605 | Bacteria | 1238 |
| 71 | Ga0466719_189128 | 3300042606 | Bacteria | 5568 |
| 72 | Ga0466719_310245 | 3300042606 | Bacteria | 9151 |
| 73 | Ga0466719_499316 | 3300042606 | Bacteria | 3121 |
| 74 | Ga0466720_000163 | 3300042607 | Bacteria | 12398 |
| 75 | Ga0466705_412262 | 3300042612 | Bacteria | 8763 |
| 76 | Ga0466711_356488 | 3300042615 | Bacteria | 3656 |
| 77 | Ga0466723_149271 | 3300042618 | Bacteria | 3836 |
| 78 | Ga0466728_151580 | 3300042620 | Bacteria | 15860 |
| 79 | Ga0466728_223594 | 3300042620 | Bacteria | 4512 |
| 80 | Ga0466728_295988 | 3300042620 | Bacteria | 11437 |
| 81 | Ga0466735_007886 | 3300042624 | Bacteria | 2708 |
| 82 | Ga0466735_072412 | 3300042624 | Bacteria | 1162 |
| 83 | Ga0466735_191275 | 3300042624 | Bacteria | 1620 |
| 84 | Ga0466704_499287 | 3300042643 | Bacteria | 13174 |
| 85 | Ga0466709_224487 | 3300042648 | Bacteria | 13774 |
| 86 | Ga0466708_186030 | 3300042652 | Bacteria | 4344 |
| 87 | Ga0466705_121424 | 3300042612 | Bacteria | 14439 |
| 88 | Ga0466705_292356 | 3300042612 | Bacteria | 2993 |
| 89 | Ga0123353_10156019 | 3300010167 | Bacteria | 3638 |
| 90 | Ga0456237_0006164 | 3300041968 | Bacteria | 1887 |
| 91 | Ga0466690_062659 | 3300042590 | Bacteria | 5439 |
| 92 | Ga0466692_152145 | 3300042591 | Bacteria | 2312 |
| 93 | Ga0466707_359210 | 3300042601 | Bacteria | 1216 |
| 94 | Ga0466707_385362 | 3300042601 | Bacteria | 17609 |
| 95 | Ga0466716_147588 | 3300042605 | Bacteria | 6457 |
| 96 | Ga0466719_344165 | 3300042606 | Bacteria | 24438 |
| 97 | Ga0466720_189402 | 3300042607 | Bacteria | 39752 |
| 98 | Ga0466712_166586 | 3300042614 | Bacteria | 1701 |
| 99 | Ga0466723_063655 | 3300042618 | Bacteria | 5949 |
| 100 | Ga0466728_008305 | 3300042620 | Bacteria | 3549 |
| 101 | JGI24702J35022_10000897 | 3300002462 | Bacteria | 18517 |
| 102 | Ga0074263_106295 | 3300005485 | Bacteria | 1258 |
| 103 | Ga0466735_014738 | 3300042624 | Bacteria | 5180 |
| 104 | Ga0466704_456950 | 3300042643 | Bacteria | 2889 |
| 105 | Ga0466704_500375 | 3300042643 | Bacteria | 1585 |
| 106 | Ga0466704_547320 | 3300042643 | Bacteria | 5106 |
| 107 | Ga0466708_049951 | 3300042652 | Bacteria | 2481 |
| 108 | Ga0466732_342105 | 3300042656 | Bacteria | 24480 |
| 109 | Ga0264413_112515 | 3300024493 | Bacteria | 3341 |
| 110 | Ga0466691_170180 | 3300042593 | Bacteria | 4791 |
| 111 | Ga0466691_178227 | 3300042593 | Unclassified | 6276 |
| 112 | Ga0466691_181813 | 3300042593 | Bacteria | 9144 |
| 113 | Ga0466706_233350 | 3300042599 | Bacteria | 9881 |
| 114 | Ga0466722_227900 | 3300042609 | Bacteria | 19710 |
| 115 | Ga0466711_348833 | 3300042615 | Bacteria | 2395 |
| 116 | Ga0466715_093910 | 3300042616 | Bacteria | 5232 |
| 117 | Ga0466715_111095 | 3300042616 | Bacteria | 92411 |
| 118 | Ga0466715_202298 | 3300042616 | Bacteria | 4778 |
| 119 | Ga0466723_026305 | 3300042618 | Bacteria | 6123 |
| 120 | Ga0466726_185975 | 3300042619 | Unclassified | 2316 |
| 121 | Ga0466728_282607 | 3300042620 | Bacteria | 5154 |
| 122 | Ga0466729_284398 | 3300042621 | Bacteria | 6151 |
| 123 | Ga0466734_059016 | 3300042623 | Bacteria | 1168 |
| 124 | Ga0466703_257110 | 3300042636 | Bacteria | 5923 |
| 125 | Ga0466703_258562 | 3300042636 | Bacteria | 3029 |
| 126 | Ga0466704_144769 | 3300042643 | Bacteria | 13285 |
| 127 | Ga0466709_139875 | 3300042648 | Bacteria | 5714 |
| 128 | Ga0466709_167841 | 3300042648 | Bacteria | 3329 |
| 129 | Ga0466708_038995 | 3300042652 | Bacteria | 14766 |
| 130 | Ga0466708_202930 | 3300042652 | Bacteria | 11826 |
| 131 | Ga0466727_170975 | 3300042655 | Bacteria | 5967 |
| 132 | Ga0466705_228743 | 3300042612 | Bacteria | 3713 |
| 133 | Ga0466705_236687 | 3300042612 | Bacteria | 11185 |
| 134 | Ga0123357_10133596 | 3300009784 | Bacteria | 3078 |
| 135 | Ga0466691_022644 | 3300042593 | Bacteria | 9556 |
| 136 | Ga0466691_135053 | 3300042593 | Bacteria | 5475 |
| 137 | Ga0466696_138824 | 3300042596 | Bacteria | 1153 |
| 138 | Ga0466707_103616 | 3300042601 | Bacteria | 3266 |
| 139 | Ga0466716_214456 | 3300042605 | Bacteria | 3721 |
| 140 | Ga0466716_326536 | 3300042605 | Bacteria | 3471 |
| 141 | Ga0466719_214943 | 3300042606 | Bacteria | 15359 |
| 142 | Ga0466720_032906 | 3300042607 | Bacteria | 1716 |
| 143 | Ga0466720_141815 | 3300042607 | Bacteria | 13412 |
| 144 | Ga0466722_037884 | 3300042609 | Bacteria | 25328 |
| 145 | Ga0466711_003981 | 3300042615 | Bacteria | 23959 |
| 146 | Ga0466723_094323 | 3300042618 | Bacteria | 6293 |
| 147 | Ga0466726_009545 | 3300042619 | Bacteria | 5732 |
| 148 | Ga0466726_317544 | 3300042619 | Bacteria | 6012 |
| 149 | Ga0466728_206646 | 3300042620 | Bacteria | 2785 |
| 150 | JGI24702J35022_10010354 | 3300002462 | Unclassified | 5213 |
| 151 | Ga0466703_197593 | 3300042636 | Bacteria | 3199 |
| 152 | Ga0466733_051916 | 3300042659 | Bacteria | 1357 |
| 153 | Ga0123357_10071315 | 3300009784 | Bacteria | 4607 |
| 154 | Ga0123353_10319795 | 3300010167 | Bacteria | 2356 |
| 155 | Ga0466693_054829 | 3300042592 | Bacteria | 1439 |
| 156 | Ga0466696_212353 | 3300042596 | Bacteria | 3675 |
| 157 | Ga0466699_017140 | 3300042597 | Bacteria | 3400 |
| 158 | Ga0466700_190702 | 3300042600 | Bacteria | 1136 |
| 159 | Ga0466700_286789 | 3300042600 | Bacteria | 2926 |
| 160 | Ga0466716_004689 | 3300042605 | Bacteria | 8740 |
| 161 | Ga0466716_148934 | 3300042605 | Bacteria | 5060 |
| 162 | Ga0466719_406687 | 3300042606 | Unclassified | 1365 |
| 163 | Ga0466719_564238 | 3300042606 | Bacteria | 7684 |
| 164 | Ga0466720_002740 | 3300042607 | Bacteria | 12970 |
| 165 | Ga0466720_053804 | 3300042607 | Bacteria | 29860 |
| 166 | Ga0466720_094457 | 3300042607 | Bacteria | 2183 |
| 167 | Ga0466711_169095 | 3300042615 | Bacteria | 18446 |
| 168 | Ga0466715_427264 | 3300042616 | Bacteria | 4577 |
| 169 | Ga0466723_001565 | 3300042618 | Bacteria | 19551 |
| 170 | Ga0466723_163969 | 3300042618 | Bacteria | 3935 |
| 171 | Ga0466726_465444 | 3300042619 | Bacteria | 6269 |
| 172 | Ga0466728_025221 | 3300042620 | Bacteria | 4815 |
| 173 | Ga0466728_099734 | 3300042620 | Bacteria | 18107 |
| 174 | Ga0466703_186550 | 3300042636 | Bacteria | 31727 |
| 175 | Ga0466709_187137 | 3300042648 | Bacteria | 4148 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 79 | 276 | 0.82 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.