Protein Family IF06624
Metagenome
Isolate
264
Members
77
Samples
244
Scaffolds
406.45
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_038830|Ga0466720_038830_39_1502
- Length
- 487 aa
- Sequence
- MLKKGCFSGLSVSGNSNVFNFVCCMAHWGLLFIKIGIFEYNALLMVDCQVKDGGQEPGTGGVSLINLQLHCKFISSCIDNDTNIAYIQIMYYERTLSKTLKQTSDFFKVVLLTGPRQVGKTTLLENIKEPDRSYVSLDDMEILMMAQEDPAHFFERFPPPVLIDEVQKAPNLFPYIKAIADKSKKKGQFWLTGSQQFQLMKNVSESLAGRGAILDLQGFSQSEKEKDETRPAFIPEIPLQTKRPVWTTQKTFDVIVRGSFPQLFDGTPSSLFYSSYIRTYIERDVREILKITNEHAFLKFLKITAGRTGQVLNYNNVARDIEVSVNTVKSWVSVLETSGLIYLLPPYSRNLRKRAIKTPKLYFLDTGLCCYLTGITTGKMAMDHQISGALFETYAVSEILKSYWHNGERPFAYFYRDTLGKEIDLILEANGKLWPVEIKQTVSPNPKMVQNFDILSGEECGKGALICTANKFIPMNKDVNIIPVSYI
Sample Types
Isolate
7.6%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.3%
Unclassified
30.7%
Kalotermitidae
17.3%
Termopsidae
4.0%
Rhinotermitidae
4.0%
Hodotermitidae
1.3%
Passalidae
1.3%
Taxonomy
Archaea
7
Bacteria
238
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 2 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 3 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 4 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 5 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 6 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 7 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 18 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 19 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 20 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 32 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 33 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 36 | 2820477775 | Unclassified Firmicutes Lab288P1bin79 | Isolate | Unclassified |
| 37 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 38 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 39 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 40 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 41 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 49 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 55 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 56 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 57 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 58 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 59 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 60 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 63 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 64 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 65 | 2820193510 | Unclassified Planctomycetes Emb289P3bin83 | Isolate | Unclassified |
| 66 | 2820806175 | Unclassified Actinobacteria Th196P3bin122 | Isolate | Unclassified |
| 67 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 68 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 69 | 2820679524 | Unclassified Firmicutes Co191P1bin94 | Isolate | Unclassified |
| 70 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 71 | 2820917597 | Unclassified Actinobacteria Emb289P3bin57 | Isolate | Unclassified |
| 72 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 73 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 74 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 75 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 76 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 77 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_083128 | 3300042612 | Bacteria | 3131 |
| 2 | Ga0466701_101150 | 3300042598 | Archaea | 8858 |
| 3 | Ga0466706_070044 | 3300042599 | Bacteria | 1913 |
| 4 | Ga0466706_195898 | 3300042599 | Bacteria | 3052 |
| 5 | Ga0466719_054545 | 3300042606 | Bacteria | 3231 |
| 6 | Ga0466719_500305 | 3300042606 | Bacteria | 2364 |
| 7 | Ga0466722_116728 | 3300042609 | Bacteria | 1702 |
| 8 | Ga0466718_030974 | 3300042617 | Bacteria | 10517 |
| 9 | Ga0466726_447851 | 3300042619 | Bacteria | 3031 |
| 10 | Ga0466726_484740 | 3300042619 | Bacteria | 11572 |
| 11 | Ga0466728_280138 | 3300042620 | Bacteria | 1768 |
| 12 | Ga0466729_016821 | 3300042621 | Bacteria | 2880 |
| 13 | Ga0466729_150682 | 3300042621 | Bacteria | 2916 |
| 14 | Ga0466729_261531 | 3300042621 | Bacteria | 9203 |
| 15 | Ga0466735_021328 | 3300042624 | Bacteria | 13415 |
| 16 | Ga0466702_151468 | 3300042635 | Bacteria | 1628 |
| 17 | Ga0466702_414194 | 3300042635 | Bacteria | 2273 |
| 18 | Ga0466703_053256 | 3300042636 | Bacteria | 45065 |
| 19 | Ga0466709_103545 | 3300042648 | Unclassified | 14621 |
| 20 | Ga0466708_287716 | 3300042652 | Bacteria | 3620 |
| 21 | Ga0123356_10040036 | 3300010049 | Bacteria | 4366 |
| 22 | Ga0123353_10102380 | 3300010167 | Unclassified | 4616 |
| 23 | Ga0123354_10185398 | 3300010882 | Bacteria | 2356 |
| 24 | Ga0466692_110376 | 3300042591 | Bacteria | 4013 |
| 25 | JGI24698J34947_10005293 | 3300002449 | Bacteria | 7079 |
| 26 | JGI24698J34947_10019701 | 3300002449 | Bacteria | 3635 |
| 27 | JGI24695J34938_10000471 | 3300002450 | Bacteria | 39062 |
| 28 | Ga0466733_172333 | 3300042659 | Bacteria | 2787 |
| 29 | Ga0466706_163257 | 3300042599 | Bacteria | 5441 |
| 30 | Ga0466706_217132 | 3300042599 | Bacteria | 5021 |
| 31 | Ga0466706_220775 | 3300042599 | Bacteria | 1930 |
| 32 | Ga0466700_362396 | 3300042600 | Bacteria | 2759 |
| 33 | Ga0466707_361199 | 3300042601 | Bacteria | 1387 |
| 34 | Ga0466715_300368 | 3300042616 | Bacteria | 2021 |
| 35 | Ga0466718_112681 | 3300042617 | Bacteria | 2408 |
| 36 | Ga0466718_153973 | 3300042617 | Bacteria | 3300 |
| 37 | Ga0466723_259146 | 3300042618 | Bacteria | 7126 |
| 38 | Ga0466729_132125 | 3300042621 | Bacteria | 2015 |
| 39 | Ga0466703_266068 | 3300042636 | Bacteria | 6342 |
| 40 | Ga0466725_238257 | 3300042654 | Bacteria | 11417 |
| 41 | Ga0466727_334800 | 3300042655 | Bacteria | 1408 |
| 42 | Ga0264413_101847 | 3300024493 | Bacteria | 86591 |
| 43 | Ga0264413_118993 | 3300024493 | Bacteria | 6175 |
| 44 | Ga0466694_208592 | 3300042594 | Bacteria | 1802 |
| 45 | JGI24702J35022_10004239 | 3300002462 | Bacteria | 8563 |
| 46 | Ga0068305_10044766 | 3300005083 | Unclassified | 3063 |
| 47 | Ga0466697_075936 | 3300042611 | Bacteria | 2071 |
| 48 | Ga0466697_155656 | 3300042611 | Bacteria | 1690 |
| 49 | Ga0466733_031990 | 3300042659 | Bacteria | 21694 |
| 50 | Ga0466706_095506 | 3300042599 | Bacteria | 1969 |
| 51 | Ga0466700_446737 | 3300042600 | Bacteria | 1977 |
| 52 | Ga0466707_104446 | 3300042601 | Unclassified | 1133 |
| 53 | Ga0466707_406210 | 3300042601 | Bacteria | 1887 |
| 54 | Ga0466707_414748 | 3300042601 | Bacteria | 2140 |
| 55 | Ga0466719_430541 | 3300042606 | Bacteria | 2087 |
| 56 | Ga0466720_038830 | 3300042607 | Bacteria | 12605 |
| 57 | Ga0466720_101232 | 3300042607 | Unclassified | 2946 |
| 58 | Ga0466720_233714 | 3300042607 | Bacteria | 17306 |
| 59 | Ga0466712_194173 | 3300042614 | Bacteria | 12130 |
| 60 | Ga0466711_021160 | 3300042615 | Bacteria | 5902 |
| 61 | Ga0466715_411543 | 3300042616 | Bacteria | 2178 |
| 62 | Ga0466726_467576 | 3300042619 | Bacteria | 1922 |
| 63 | Ga0466728_401664 | 3300042620 | Bacteria | 1505 |
| 64 | Ga0466731_017042 | 3300042622 | Bacteria | 60163 |
| 65 | Ga0466704_086571 | 3300042643 | Bacteria | 65985 |
| 66 | Ga0466704_119089 | 3300042643 | Bacteria | 1977 |
| 67 | Ga0466704_316152 | 3300042643 | Bacteria | 27672 |
| 68 | Ga0123357_10221678 | 3300009784 | Bacteria | 2096 |
| 69 | Ga0123355_10096320 | 3300009826 | Bacteria | 4674 |
| 70 | Ga0123356_10000072 | 3300010049 | Bacteria | 106738 |
| 71 | Ga0123356_10332663 | 3300010049 | Bacteria | 1636 |
| 72 | Ga0123353_10546367 | 3300010167 | Bacteria | 1672 |
| 73 | Ga0415639_073773 | 3300038395 | Bacteria | 5140 |
| 74 | Ga0466690_160105 | 3300042590 | Bacteria | 10940 |
| 75 | Ga0466693_219899 | 3300042592 | Bacteria | 1577 |
| 76 | Ga0466696_298891 | 3300042596 | Bacteria | 6847 |
| 77 | JGI24698J34947_10001765 | 3300002449 | Bacteria | 11528 |
| 78 | JGI24702J35022_10027521 | 3300002462 | Bacteria | 3058 |
| 79 | JGI24696J40584_12961527 | 3300002834 | Bacteria | 19824 |
| 80 | Ga0072941_1086805 | 3300005201 | Bacteria | 1785 |
| 81 | Ga0123357_10000067 | 3300009784 | Bacteria | 84688 |
| 82 | Ga0466697_186764 | 3300042611 | Bacteria | 1884 |
| 83 | Ga0466732_339774 | 3300042656 | Unclassified | 1685 |
| 84 | Ga0466707_127887 | 3300042601 | Bacteria | 1799 |
| 85 | Ga0466707_361934 | 3300042601 | Bacteria | 1839 |
| 86 | Ga0466713_035059 | 3300042602 | Bacteria | 2700 |
| 87 | Ga0466713_099275 | 3300042602 | Bacteria | 3838 |
| 88 | Ga0466719_057948 | 3300042606 | Bacteria | 2075 |
| 89 | Ga0466719_074103 | 3300042606 | Bacteria | 2721 |
| 90 | Ga0466722_052930 | 3300042609 | Bacteria | 3489 |
| 91 | Ga0466711_439631 | 3300042615 | Bacteria | 3773 |
| 92 | Ga0466723_372581 | 3300042618 | Bacteria | 8234 |
| 93 | Ga0466726_074039 | 3300042619 | Bacteria | 1458 |
| 94 | Ga0466728_383321 | 3300042620 | Bacteria | 5790 |
| 95 | Ga0466731_286318 | 3300042622 | Bacteria | 3603 |
| 96 | Ga0466734_053156 | 3300042623 | Archaea | 51245 |
| 97 | Ga0466702_062533 | 3300042635 | Bacteria | 1845 |
| 98 | Ga0466702_074150 | 3300042635 | Bacteria | 3182 |
| 99 | Ga0466702_330158 | 3300042635 | Bacteria | 13833 |
| 100 | Ga0466702_441710 | 3300042635 | Bacteria | 1842 |
| 101 | Ga0466702_447073 | 3300042635 | Bacteria | 1977 |
| 102 | Ga0466704_096164 | 3300042643 | Bacteria | 6169 |
| 103 | Ga0466704_125943 | 3300042643 | Bacteria | 12098 |
| 104 | Ga0466704_596461 | 3300042643 | Bacteria | 93141 |
| 105 | Ga0466709_082573 | 3300042648 | Bacteria | 19141 |
| 106 | Ga0466709_310671 | 3300042648 | Bacteria | 31585 |
| 107 | Ga0123357_10072556 | 3300009784 | Bacteria | 4562 |
| 108 | Ga0123355_10004295 | 3300009826 | Bacteria | 20717 |
| 109 | Ga0123356_10000044 | 3300010049 | Bacteria | 132964 |
| 110 | Ga0123356_10063574 | 3300010049 | Bacteria | 3449 |
| 111 | Ga0123353_10227705 | 3300010167 | Bacteria | 2909 |
| 112 | Ga0123353_10245294 | 3300010167 | Bacteria | 2779 |
| 113 | Ga0123353_10490691 | 3300010167 | Bacteria | 1793 |
| 114 | Ga0123354_10224127 | 3300010882 | Bacteria | 1987 |
| 115 | Ga0415639_219598 | 3300038395 | Unclassified | 1623 |
| 116 | Ga0466691_055629 | 3300042593 | Bacteria | 5213 |
| 117 | JGI24698J34947_10048743 | 3300002449 | Bacteria | 2143 |
| 118 | JGI24702J35022_10021284 | 3300002462 | Bacteria | 3518 |
| 119 | Ga0072941_1046411 | 3300005201 | Bacteria | 4654 |
| 120 | Ga0466706_060723 | 3300042599 | Bacteria | 2650 |
| 121 | Ga0466706_085104 | 3300042599 | Bacteria | 5150 |
| 122 | Ga0466707_405228 | 3300042601 | Bacteria | 4333 |
| 123 | Ga0466713_023553 | 3300042602 | Bacteria | 168712 |
| 124 | Ga0466713_026458 | 3300042602 | Bacteria | 39956 |
| 125 | Ga0466713_095526 | 3300042602 | Bacteria | 106941 |
| 126 | Ga0466713_146026 | 3300042602 | Bacteria | 12303 |
| 127 | Ga0466714_034517 | 3300042603 | Bacteria | 2025 |
| 128 | Ga0466722_208563 | 3300042609 | Bacteria | 2594 |
| 129 | Ga0466712_232101 | 3300042614 | Unclassified | 1718 |
| 130 | Ga0466726_165947 | 3300042619 | Bacteria | 1915 |
| 131 | Ga0466726_256881 | 3300042619 | Bacteria | 1410 |
| 132 | Ga0466728_246993 | 3300042620 | Bacteria | 5139 |
| 133 | Ga0466728_334452 | 3300042620 | Bacteria | 73486 |
| 134 | Ga0466729_022867 | 3300042621 | Bacteria | 1895 |
| 135 | Ga0466731_336546 | 3300042622 | Bacteria | 4171 |
| 136 | Ga0466702_103610 | 3300042635 | Bacteria | 2061 |
| 137 | Ga0466709_358780 | 3300042648 | Bacteria | 4706 |
| 138 | Ga0466727_161175 | 3300042655 | Bacteria | 16380 |
| 139 | Ga0123356_10058215 | 3300010049 | Unclassified | 3603 |
| 140 | Ga0123356_10140122 | 3300010049 | Bacteria | 2384 |
| 141 | Ga0123353_10422980 | 3300010167 | Bacteria | 1973 |
| 142 | Ga0264413_137577 | 3300024493 | Unclassified | 6987 |
| 143 | Ga0466692_138029 | 3300042591 | Bacteria | 8108 |
| 144 | AustNasuHG_c1010281 | 3300000089 | Bacteria | 3264 |
| 145 | JGI24698J34947_10012618 | 3300002449 | Bacteria | 4629 |
| 146 | JGI24702J35022_10003497 | 3300002462 | Bacteria | 9460 |
| 147 | JGI24702J35022_10003897 | 3300002462 | Bacteria | 8949 |
| 148 | JGI24702J35022_10043065 | 3300002462 | Bacteria | 2404 |
| 149 | JGI24702J35022_10123315 | 3300002462 | Bacteria | 1433 |
| 150 | JGI24705J35276_12227624 | 3300002504 | Bacteria | 3035 |
| 151 | Ga0466733_165955 | 3300042659 | Bacteria | 2228 |
| 152 | Ga0466706_017940 | 3300042599 | Bacteria | 10793 |
| 153 | Ga0466706_060131 | 3300042599 | Bacteria | 4870 |
| 154 | Ga0466706_072866 | 3300042599 | Unclassified | 9434 |
| 155 | Ga0466700_254672 | 3300042600 | Bacteria | 254759 |
| 156 | Ga0466707_141239 | 3300042601 | Bacteria | 3717 |
| 157 | Ga0466714_094948 | 3300042603 | Bacteria | 2545 |
| 158 | Ga0466714_118872 | 3300042603 | Bacteria | 1865 |
| 159 | Ga0466720_128577 | 3300042607 | Unclassified | 1597 |
| 160 | Ga0466722_096255 | 3300042609 | Bacteria | 5739 |
| 161 | Ga0466718_098543 | 3300042617 | Archaea | 2016 |
| 162 | Ga0466731_068784 | 3300042622 | Bacteria | 3747 |
| 163 | Ga0466703_023933 | 3300042636 | Bacteria | 1786 |
| 164 | Ga0466703_399615 | 3300042636 | Bacteria | 2876 |
| 165 | Ga0466703_411567 | 3300042636 | Unclassified | 1433 |
| 166 | Ga0466704_512425 | 3300042643 | Bacteria | 40327 |
| 167 | Ga0466724_59900 | 3300042649 | Bacteria | 1607 |
| 168 | Ga0466727_293541 | 3300042655 | Archaea | 4761 |
| 169 | Ga0123356_10002355 | 3300010049 | Bacteria | 20286 |
| 170 | Ga0123356_10003779 | 3300010049 | Bacteria | 15763 |
| 171 | Ga0123353_10267802 | 3300010167 | Bacteria | 2634 |
| 172 | Ga0123353_10497962 | 3300010167 | Bacteria | 1776 |
| 173 | Ga0123354_10220279 | 3300010882 | Bacteria | 2019 |
| 174 | Ga0264413_101963 | 3300024493 | Bacteria | 19615 |
| 175 | Ga0466692_170224 | 3300042591 | Bacteria | 3547 |
| 176 | Ga0466694_211334 | 3300042594 | Bacteria | 2719 |
| 177 | Ga0466696_458642 | 3300042596 | Bacteria | 5039 |
| 178 | IMNBL1DRAFT_c0017162 | 3300000062 | Bacteria | 3063 |
| 179 | JGI24698J34947_10012492 | 3300002449 | Bacteria | 4654 |
| 180 | JGI24698J34947_10022326 | 3300002449 | Bacteria | 3395 |
| 181 | JGI24702J35022_10000369 | 3300002462 | Bacteria | 26699 |
| 182 | Ga0466705_171019 | 3300042612 | Bacteria | 78873 |
| 183 | Ga0466705_329199 | 3300042612 | Bacteria | 3531 |
| 184 | Ga0466701_067197 | 3300042598 | Archaea | 2207 |
| 185 | Ga0466706_037471 | 3300042599 | Archaea | 1710 |
| 186 | Ga0466706_051704 | 3300042599 | Bacteria | 1743 |
| 187 | Ga0466706_212536 | 3300042599 | Unclassified | 2798 |
| 188 | Ga0466714_070424 | 3300042603 | Bacteria | 2666 |
| 189 | Ga0466722_190728 | 3300042609 | Bacteria | 4423 |
| 190 | Ga0466722_260173 | 3300042609 | Bacteria | 3396 |
| 191 | Ga0466712_012143 | 3300042614 | Bacteria | 4944 |
| 192 | Ga0466712_162771 | 3300042614 | Unclassified | 1999 |
| 193 | Ga0466711_215189 | 3300042615 | Bacteria | 54014 |
| 194 | Ga0466715_044345 | 3300042616 | Bacteria | 1846 |
| 195 | Ga0466726_021187 | 3300042619 | Archaea | 4647 |
| 196 | Ga0466729_201743 | 3300042621 | Bacteria | 1886 |
| 197 | Ga0466735_013813 | 3300042624 | Bacteria | 4944 |
| 198 | Ga0466702_437464 | 3300042635 | Bacteria | 1886 |
| 199 | Ga0466703_205020 | 3300042636 | Bacteria | 117626 |
| 200 | Ga0466725_013077 | 3300042654 | Bacteria | 4642 |
| 201 | Ga0466727_176203 | 3300042655 | Bacteria | 3980 |
| 202 | Ga0123356_10000972 | 3300010049 | Bacteria | 31797 |
| 203 | Ga0123356_10001065 | 3300010049 | Bacteria | 30436 |
| 204 | Ga0123356_10011626 | 3300010049 | Bacteria | 8575 |
| 205 | Ga0123356_10033547 | 3300010049 | Bacteria | 4800 |
| 206 | Ga0123354_10399554 | 3300010882 | Bacteria | 1165 |
| 207 | Ga0264413_131576 | 3300024493 | Unclassified | 2656 |
| 208 | Ga0415639_025496 | 3300038395 | Bacteria | 7105 |
| 209 | Ga0466690_270517 | 3300042590 | Bacteria | 14318 |
| 210 | Ga0466690_431669 | 3300042590 | Bacteria | 2345 |
| 211 | Ga0466691_050213 | 3300042593 | Bacteria | 33690 |
| 212 | Ga0466696_055731 | 3300042596 | Bacteria | 1657 |
| 213 | Ga0466696_272395 | 3300042596 | Bacteria | 1839 |
| 214 | Ga0466699_029882 | 3300042597 | Bacteria | 13459 |
| 215 | AustNasuHG_c1012351 | 3300000089 | Bacteria | 2948 |
| 216 | Ga0068305_10080408 | 3300005083 | Bacteria | 4835 |
| 217 | Ga0072940_1313997 | 3300005200 | Bacteria | 1510 |
| 218 | Ga0466705_027419 | 3300042612 | Bacteria | 37190 |
| 219 | Ga0466706_062297 | 3300042599 | Bacteria | 2510 |
| 220 | Ga0466713_015708 | 3300042602 | Bacteria | 7085 |
| 221 | Ga0466713_048320 | 3300042602 | Bacteria | 25194 |
| 222 | Ga0466713_095358 | 3300042602 | Bacteria | 22885 |
| 223 | Ga0466719_029968 | 3300042606 | Bacteria | 5503 |
| 224 | Ga0466720_048472 | 3300042607 | Bacteria | 8827 |
| 225 | Ga0466720_116740 | 3300042607 | Bacteria | 72912 |
| 226 | Ga0466720_176669 | 3300042607 | Bacteria | 59276 |
| 227 | Ga0466720_219301 | 3300042607 | Bacteria | 5602 |
| 228 | Ga0466712_075804 | 3300042614 | Bacteria | 38150 |
| 229 | Ga0466711_469473 | 3300042615 | Bacteria | 1657 |
| 230 | Ga0466715_064411 | 3300042616 | Bacteria | 4737 |
| 231 | Ga0466715_147581 | 3300042616 | Bacteria | 8631 |
| 232 | Ga0466728_420241 | 3300042620 | Bacteria | 10657 |
| 233 | Ga0466729_224711 | 3300042621 | Bacteria | 1693 |
| 234 | Ga0466731_085326 | 3300042622 | Bacteria | 3487 |
| 235 | Ga0466702_449347 | 3300042635 | Bacteria | 2007 |
| 236 | Ga0466703_021743 | 3300042636 | Bacteria | 2203 |
| 237 | Ga0466704_004138 | 3300042643 | Bacteria | 4090 |
| 238 | Ga0466704_330195 | 3300042643 | Unclassified | 2850 |
| 239 | Ga0466727_059955 | 3300042655 | Bacteria | 4288 |
| 240 | Ga0123356_10001986 | 3300010049 | Bacteria | 22131 |
| 241 | Ga0123353_10282503 | 3300010167 | Bacteria | 2548 |
| 242 | Ga0123353_10396758 | 3300010167 | Unclassified | 2055 |
| 243 | Ga0264413_153952 | 3300024493 | Unclassified | 4834 |
| 244 | JGI24699J35502_11100094 | 3300002509 | Bacteria | 2338 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.