Protein Family IF06624

Metagenome Isolate
264 Members
77 Samples
244 Scaffolds
406.45 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_038830|Ga0466720_038830_39_1502
Length
487 aa
Sequence
MLKKGCFSGLSVSGNSNVFNFVCCMAHWGLLFIKIGIFEYNALLMVDCQVKDGGQEPGTGGVSLINLQLHCKFISSCIDNDTNIAYIQIMYYERTLSKTLKQTSDFFKVVLLTGPRQVGKTTLLENIKEPDRSYVSLDDMEILMMAQEDPAHFFERFPPPVLIDEVQKAPNLFPYIKAIADKSKKKGQFWLTGSQQFQLMKNVSESLAGRGAILDLQGFSQSEKEKDETRPAFIPEIPLQTKRPVWTTQKTFDVIVRGSFPQLFDGTPSSLFYSSYIRTYIERDVREILKITNEHAFLKFLKITAGRTGQVLNYNNVARDIEVSVNTVKSWVSVLETSGLIYLLPPYSRNLRKRAIKTPKLYFLDTGLCCYLTGITTGKMAMDHQISGALFETYAVSEILKSYWHNGERPFAYFYRDTLGKEIDLILEANGKLWPVEIKQTVSPNPKMVQNFDILSGEECGKGALICTANKFIPMNKDVNIIPVSYI

πŸ“Š Sample Types

Isolate 7.6%
Metagenome 92.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 41.3%
Unclassified 30.7%
Kalotermitidae 17.3%
Termopsidae 4.0%
Rhinotermitidae 4.0%
Hodotermitidae 1.3%
Passalidae 1.3%

🌳 Taxonomy

Archaea 7
Bacteria 238
Eukaryota 0
Viruses 0
Unclassified 19

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
2 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
3 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
4 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
5 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
6 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
7 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
10 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
13 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
14 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
15 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
18 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
19 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
20 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
23 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
31 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
36 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
37 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
38 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
39 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
40 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
41 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
43 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
48 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
49 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
50 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
51 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
55 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
56 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
57 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
58 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
59 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
60 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
61 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
62 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
63 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
64 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
65 2820193510 Unclassified Planctomycetes Emb289P3bin83 Isolate Unclassified
66 2820806175 Unclassified Actinobacteria Th196P3bin122 Isolate Unclassified
67 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
68 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
69 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
70 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
71 2820917597 Unclassified Actinobacteria Emb289P3bin57 Isolate Unclassified
72 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
73 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
74 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
75 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
76 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
77 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_083128 3300042612 Bacteria 3131
2 Ga0466701_101150 3300042598 Archaea 8858
3 Ga0466706_070044 3300042599 Bacteria 1913
4 Ga0466706_195898 3300042599 Bacteria 3052
5 Ga0466719_054545 3300042606 Bacteria 3231
6 Ga0466719_500305 3300042606 Bacteria 2364
7 Ga0466722_116728 3300042609 Bacteria 1702
8 Ga0466718_030974 3300042617 Bacteria 10517
9 Ga0466726_447851 3300042619 Bacteria 3031
10 Ga0466726_484740 3300042619 Bacteria 11572
11 Ga0466728_280138 3300042620 Bacteria 1768
12 Ga0466729_016821 3300042621 Bacteria 2880
13 Ga0466729_150682 3300042621 Bacteria 2916
14 Ga0466729_261531 3300042621 Bacteria 9203
15 Ga0466735_021328 3300042624 Bacteria 13415
16 Ga0466702_151468 3300042635 Bacteria 1628
17 Ga0466702_414194 3300042635 Bacteria 2273
18 Ga0466703_053256 3300042636 Bacteria 45065
19 Ga0466709_103545 3300042648 Unclassified 14621
20 Ga0466708_287716 3300042652 Bacteria 3620
21 Ga0123356_10040036 3300010049 Bacteria 4366
22 Ga0123353_10102380 3300010167 Unclassified 4616
23 Ga0123354_10185398 3300010882 Bacteria 2356
24 Ga0466692_110376 3300042591 Bacteria 4013
25 JGI24698J34947_10005293 3300002449 Bacteria 7079
26 JGI24698J34947_10019701 3300002449 Bacteria 3635
27 JGI24695J34938_10000471 3300002450 Bacteria 39062
28 Ga0466733_172333 3300042659 Bacteria 2787
29 Ga0466706_163257 3300042599 Bacteria 5441
30 Ga0466706_217132 3300042599 Bacteria 5021
31 Ga0466706_220775 3300042599 Bacteria 1930
32 Ga0466700_362396 3300042600 Bacteria 2759
33 Ga0466707_361199 3300042601 Bacteria 1387
34 Ga0466715_300368 3300042616 Bacteria 2021
35 Ga0466718_112681 3300042617 Bacteria 2408
36 Ga0466718_153973 3300042617 Bacteria 3300
37 Ga0466723_259146 3300042618 Bacteria 7126
38 Ga0466729_132125 3300042621 Bacteria 2015
39 Ga0466703_266068 3300042636 Bacteria 6342
40 Ga0466725_238257 3300042654 Bacteria 11417
41 Ga0466727_334800 3300042655 Bacteria 1408
42 Ga0264413_101847 3300024493 Bacteria 86591
43 Ga0264413_118993 3300024493 Bacteria 6175
44 Ga0466694_208592 3300042594 Bacteria 1802
45 JGI24702J35022_10004239 3300002462 Bacteria 8563
46 Ga0068305_10044766 3300005083 Unclassified 3063
47 Ga0466697_075936 3300042611 Bacteria 2071
48 Ga0466697_155656 3300042611 Bacteria 1690
49 Ga0466733_031990 3300042659 Bacteria 21694
50 Ga0466706_095506 3300042599 Bacteria 1969
51 Ga0466700_446737 3300042600 Bacteria 1977
52 Ga0466707_104446 3300042601 Unclassified 1133
53 Ga0466707_406210 3300042601 Bacteria 1887
54 Ga0466707_414748 3300042601 Bacteria 2140
55 Ga0466719_430541 3300042606 Bacteria 2087
56 Ga0466720_038830 3300042607 Bacteria 12605
57 Ga0466720_101232 3300042607 Unclassified 2946
58 Ga0466720_233714 3300042607 Bacteria 17306
59 Ga0466712_194173 3300042614 Bacteria 12130
60 Ga0466711_021160 3300042615 Bacteria 5902
61 Ga0466715_411543 3300042616 Bacteria 2178
62 Ga0466726_467576 3300042619 Bacteria 1922
63 Ga0466728_401664 3300042620 Bacteria 1505
64 Ga0466731_017042 3300042622 Bacteria 60163
65 Ga0466704_086571 3300042643 Bacteria 65985
66 Ga0466704_119089 3300042643 Bacteria 1977
67 Ga0466704_316152 3300042643 Bacteria 27672
68 Ga0123357_10221678 3300009784 Bacteria 2096
69 Ga0123355_10096320 3300009826 Bacteria 4674
70 Ga0123356_10000072 3300010049 Bacteria 106738
71 Ga0123356_10332663 3300010049 Bacteria 1636
72 Ga0123353_10546367 3300010167 Bacteria 1672
73 Ga0415639_073773 3300038395 Bacteria 5140
74 Ga0466690_160105 3300042590 Bacteria 10940
75 Ga0466693_219899 3300042592 Bacteria 1577
76 Ga0466696_298891 3300042596 Bacteria 6847
77 JGI24698J34947_10001765 3300002449 Bacteria 11528
78 JGI24702J35022_10027521 3300002462 Bacteria 3058
79 JGI24696J40584_12961527 3300002834 Bacteria 19824
80 Ga0072941_1086805 3300005201 Bacteria 1785
81 Ga0123357_10000067 3300009784 Bacteria 84688
82 Ga0466697_186764 3300042611 Bacteria 1884
83 Ga0466732_339774 3300042656 Unclassified 1685
84 Ga0466707_127887 3300042601 Bacteria 1799
85 Ga0466707_361934 3300042601 Bacteria 1839
86 Ga0466713_035059 3300042602 Bacteria 2700
87 Ga0466713_099275 3300042602 Bacteria 3838
88 Ga0466719_057948 3300042606 Bacteria 2075
89 Ga0466719_074103 3300042606 Bacteria 2721
90 Ga0466722_052930 3300042609 Bacteria 3489
91 Ga0466711_439631 3300042615 Bacteria 3773
92 Ga0466723_372581 3300042618 Bacteria 8234
93 Ga0466726_074039 3300042619 Bacteria 1458
94 Ga0466728_383321 3300042620 Bacteria 5790
95 Ga0466731_286318 3300042622 Bacteria 3603
96 Ga0466734_053156 3300042623 Archaea 51245
97 Ga0466702_062533 3300042635 Bacteria 1845
98 Ga0466702_074150 3300042635 Bacteria 3182
99 Ga0466702_330158 3300042635 Bacteria 13833
100 Ga0466702_441710 3300042635 Bacteria 1842
101 Ga0466702_447073 3300042635 Bacteria 1977
102 Ga0466704_096164 3300042643 Bacteria 6169
103 Ga0466704_125943 3300042643 Bacteria 12098
104 Ga0466704_596461 3300042643 Bacteria 93141
105 Ga0466709_082573 3300042648 Bacteria 19141
106 Ga0466709_310671 3300042648 Bacteria 31585
107 Ga0123357_10072556 3300009784 Bacteria 4562
108 Ga0123355_10004295 3300009826 Bacteria 20717
109 Ga0123356_10000044 3300010049 Bacteria 132964
110 Ga0123356_10063574 3300010049 Bacteria 3449
111 Ga0123353_10227705 3300010167 Bacteria 2909
112 Ga0123353_10245294 3300010167 Bacteria 2779
113 Ga0123353_10490691 3300010167 Bacteria 1793
114 Ga0123354_10224127 3300010882 Bacteria 1987
115 Ga0415639_219598 3300038395 Unclassified 1623
116 Ga0466691_055629 3300042593 Bacteria 5213
117 JGI24698J34947_10048743 3300002449 Bacteria 2143
118 JGI24702J35022_10021284 3300002462 Bacteria 3518
119 Ga0072941_1046411 3300005201 Bacteria 4654
120 Ga0466706_060723 3300042599 Bacteria 2650
121 Ga0466706_085104 3300042599 Bacteria 5150
122 Ga0466707_405228 3300042601 Bacteria 4333
123 Ga0466713_023553 3300042602 Bacteria 168712
124 Ga0466713_026458 3300042602 Bacteria 39956
125 Ga0466713_095526 3300042602 Bacteria 106941
126 Ga0466713_146026 3300042602 Bacteria 12303
127 Ga0466714_034517 3300042603 Bacteria 2025
128 Ga0466722_208563 3300042609 Bacteria 2594
129 Ga0466712_232101 3300042614 Unclassified 1718
130 Ga0466726_165947 3300042619 Bacteria 1915
131 Ga0466726_256881 3300042619 Bacteria 1410
132 Ga0466728_246993 3300042620 Bacteria 5139
133 Ga0466728_334452 3300042620 Bacteria 73486
134 Ga0466729_022867 3300042621 Bacteria 1895
135 Ga0466731_336546 3300042622 Bacteria 4171
136 Ga0466702_103610 3300042635 Bacteria 2061
137 Ga0466709_358780 3300042648 Bacteria 4706
138 Ga0466727_161175 3300042655 Bacteria 16380
139 Ga0123356_10058215 3300010049 Unclassified 3603
140 Ga0123356_10140122 3300010049 Bacteria 2384
141 Ga0123353_10422980 3300010167 Bacteria 1973
142 Ga0264413_137577 3300024493 Unclassified 6987
143 Ga0466692_138029 3300042591 Bacteria 8108
144 AustNasuHG_c1010281 3300000089 Bacteria 3264
145 JGI24698J34947_10012618 3300002449 Bacteria 4629
146 JGI24702J35022_10003497 3300002462 Bacteria 9460
147 JGI24702J35022_10003897 3300002462 Bacteria 8949
148 JGI24702J35022_10043065 3300002462 Bacteria 2404
149 JGI24702J35022_10123315 3300002462 Bacteria 1433
150 JGI24705J35276_12227624 3300002504 Bacteria 3035
151 Ga0466733_165955 3300042659 Bacteria 2228
152 Ga0466706_017940 3300042599 Bacteria 10793
153 Ga0466706_060131 3300042599 Bacteria 4870
154 Ga0466706_072866 3300042599 Unclassified 9434
155 Ga0466700_254672 3300042600 Bacteria 254759
156 Ga0466707_141239 3300042601 Bacteria 3717
157 Ga0466714_094948 3300042603 Bacteria 2545
158 Ga0466714_118872 3300042603 Bacteria 1865
159 Ga0466720_128577 3300042607 Unclassified 1597
160 Ga0466722_096255 3300042609 Bacteria 5739
161 Ga0466718_098543 3300042617 Archaea 2016
162 Ga0466731_068784 3300042622 Bacteria 3747
163 Ga0466703_023933 3300042636 Bacteria 1786
164 Ga0466703_399615 3300042636 Bacteria 2876
165 Ga0466703_411567 3300042636 Unclassified 1433
166 Ga0466704_512425 3300042643 Bacteria 40327
167 Ga0466724_59900 3300042649 Bacteria 1607
168 Ga0466727_293541 3300042655 Archaea 4761
169 Ga0123356_10002355 3300010049 Bacteria 20286
170 Ga0123356_10003779 3300010049 Bacteria 15763
171 Ga0123353_10267802 3300010167 Bacteria 2634
172 Ga0123353_10497962 3300010167 Bacteria 1776
173 Ga0123354_10220279 3300010882 Bacteria 2019
174 Ga0264413_101963 3300024493 Bacteria 19615
175 Ga0466692_170224 3300042591 Bacteria 3547
176 Ga0466694_211334 3300042594 Bacteria 2719
177 Ga0466696_458642 3300042596 Bacteria 5039
178 IMNBL1DRAFT_c0017162 3300000062 Bacteria 3063
179 JGI24698J34947_10012492 3300002449 Bacteria 4654
180 JGI24698J34947_10022326 3300002449 Bacteria 3395
181 JGI24702J35022_10000369 3300002462 Bacteria 26699
182 Ga0466705_171019 3300042612 Bacteria 78873
183 Ga0466705_329199 3300042612 Bacteria 3531
184 Ga0466701_067197 3300042598 Archaea 2207
185 Ga0466706_037471 3300042599 Archaea 1710
186 Ga0466706_051704 3300042599 Bacteria 1743
187 Ga0466706_212536 3300042599 Unclassified 2798
188 Ga0466714_070424 3300042603 Bacteria 2666
189 Ga0466722_190728 3300042609 Bacteria 4423
190 Ga0466722_260173 3300042609 Bacteria 3396
191 Ga0466712_012143 3300042614 Bacteria 4944
192 Ga0466712_162771 3300042614 Unclassified 1999
193 Ga0466711_215189 3300042615 Bacteria 54014
194 Ga0466715_044345 3300042616 Bacteria 1846
195 Ga0466726_021187 3300042619 Archaea 4647
196 Ga0466729_201743 3300042621 Bacteria 1886
197 Ga0466735_013813 3300042624 Bacteria 4944
198 Ga0466702_437464 3300042635 Bacteria 1886
199 Ga0466703_205020 3300042636 Bacteria 117626
200 Ga0466725_013077 3300042654 Bacteria 4642
201 Ga0466727_176203 3300042655 Bacteria 3980
202 Ga0123356_10000972 3300010049 Bacteria 31797
203 Ga0123356_10001065 3300010049 Bacteria 30436
204 Ga0123356_10011626 3300010049 Bacteria 8575
205 Ga0123356_10033547 3300010049 Bacteria 4800
206 Ga0123354_10399554 3300010882 Bacteria 1165
207 Ga0264413_131576 3300024493 Unclassified 2656
208 Ga0415639_025496 3300038395 Bacteria 7105
209 Ga0466690_270517 3300042590 Bacteria 14318
210 Ga0466690_431669 3300042590 Bacteria 2345
211 Ga0466691_050213 3300042593 Bacteria 33690
212 Ga0466696_055731 3300042596 Bacteria 1657
213 Ga0466696_272395 3300042596 Bacteria 1839
214 Ga0466699_029882 3300042597 Bacteria 13459
215 AustNasuHG_c1012351 3300000089 Bacteria 2948
216 Ga0068305_10080408 3300005083 Bacteria 4835
217 Ga0072940_1313997 3300005200 Bacteria 1510
218 Ga0466705_027419 3300042612 Bacteria 37190
219 Ga0466706_062297 3300042599 Bacteria 2510
220 Ga0466713_015708 3300042602 Bacteria 7085
221 Ga0466713_048320 3300042602 Bacteria 25194
222 Ga0466713_095358 3300042602 Bacteria 22885
223 Ga0466719_029968 3300042606 Bacteria 5503
224 Ga0466720_048472 3300042607 Bacteria 8827
225 Ga0466720_116740 3300042607 Bacteria 72912
226 Ga0466720_176669 3300042607 Bacteria 59276
227 Ga0466720_219301 3300042607 Bacteria 5602
228 Ga0466712_075804 3300042614 Bacteria 38150
229 Ga0466711_469473 3300042615 Bacteria 1657
230 Ga0466715_064411 3300042616 Bacteria 4737
231 Ga0466715_147581 3300042616 Bacteria 8631
232 Ga0466728_420241 3300042620 Bacteria 10657
233 Ga0466729_224711 3300042621 Bacteria 1693
234 Ga0466731_085326 3300042622 Bacteria 3487
235 Ga0466702_449347 3300042635 Bacteria 2007
236 Ga0466703_021743 3300042636 Bacteria 2203
237 Ga0466704_004138 3300042643 Bacteria 4090
238 Ga0466704_330195 3300042643 Unclassified 2850
239 Ga0466727_059955 3300042655 Bacteria 4288
240 Ga0123356_10001986 3300010049 Bacteria 22131
241 Ga0123353_10282503 3300010167 Bacteria 2548
242 Ga0123353_10396758 3300010167 Unclassified 2055
243 Ga0264413_153952 3300024493 Unclassified 4834
244 JGI24699J35502_11100094 3300002509 Bacteria 2338

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13635 DUF4143 Domain of unknown function (DUF4143) 282 440 0.98
PF13173 AAA_14 AAA domain 108 223 0.92

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.