Protein Family IF06566

Metagenome Isolate
151 Members
77 Samples
130 Scaffolds
237.79 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_356811|Ga0466719_356811_18466_19404
Length
276 aa
Sequence
MAKQKVIIELKRLTKRYGYGANEYYALRDFDLTVRQGEFIMIMGPSGCGKTTLLNMIGMLDAPTSGEYLLNGKPVAKMSGRRKARLRSREIGFIFQGFNLINNLPVIENVALPLVYSGYSVGRRLRMASDVLANFHLERREYYMPSQLSGGQQQRVAIARSLVAGPSIILADEPTGNLDSRTSHIVMEELSDIHAAGNTIIMVTHNPALLSHATRVINMLDGQIDTDEKMVADHDLPSPNDPEKVAVRLGAKRPLGPPVVEPVEVKTKPAAGGKKK

📊 Sample Types

Isolate 13.9%
Metagenome 86.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.8%
Unclassified 24.7%
Kalotermitidae 15.1%
Culicidae 9.6%
Armadillidiidae 8.2%
Rhinotermitidae 2.7%
Passalidae 2.7%
Elmidae 1.4%
Cerambycidae 1.4%
Drosophilidae 1.4%
Termopsidae 1.4%
Hydrophilidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864755708 Massilia timonae S00006 Isolate Elmidae
2 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
12 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
15 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
16 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
19 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
20 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
21 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
22 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
26 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
27 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
28 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
29 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 2820021908 Unclassified Spirochaetes Lab288P4bin6 Isolate Unclassified
41 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
42 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
43 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
49 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
50 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
51 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
52 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
53 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
54 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
55 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
56 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
57 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
58 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
59 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
60 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
61 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
62 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
63 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
64 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
65 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
66 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
67 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
68 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
69 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
70 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
71 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
72 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
73 642555127 Elusimicrobium minutum Pei191 Isolate Unclassified
74 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
75 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
76 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
77 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_084045 3300042659 Bacteria 2580
2 Ga0466703_422853 3300042636 Bacteria 4297
3 Ga0160468_100612 3300012819 Bacteria 13272
4 Ga0160456_100030 3300012820 Bacteria 236930
5 Ga0160455_100080 3300012837 Bacteria 157559
6 Ga0160460_100170 3300012845 Bacteria 72263
7 Ga0415639_001497 3300038395 Bacteria 101208
8 Ga0123355_10028795 3300009826 Bacteria 8984
9 Ga0123353_10370409 3300010167 Bacteria 2148
10 Ga0123353_10635531 3300010167 Bacteria 1515
11 Ga0466718_016583 3300042617 Bacteria 4910
12 Ga0466726_367050 3300042619 Bacteria 6775
13 Ga0466728_226061 3300042620 Bacteria 17392
14 Ga0466704_600647 3300042643 Bacteria 3296
15 Ga0466724_30557 3300042649 Bacteria 15145
16 Ga0160456_101376 3300012820 Bacteria 5762
17 Ga0160448_100020 3300012854 Bacteria 209256
18 Ga0160435_1000170 3300012857 Unclassified 34270
19 Ga0466657_283094 3300042582 Bacteria 1169
20 Ga0466719_356811 3300042606 Bacteria 87047
21 Ga0123355_10007281 3300009826 Bacteria 16551
22 Ga0123353_10003141 3300010167 Bacteria 20741
23 2227516594 2225789004 Bacteria 3431
24 IMNBL1DRAFT_c0001403 3300000062 Bacteria 18075
25 Ga0466710_112291 3300042613 Bacteria 1087
26 Ga0466715_083219 3300042616 Bacteria 9361
27 Ga0466705_221965 3300042612 Unclassified 18507
28 Ga0466704_336982 3300042643 Bacteria 2309
29 Ga0466704_370533 3300042643 Bacteria 8825
30 Ga0160472_100216 3300012839 Bacteria 71370
31 Ga0160457_1000011 3300012858 Bacteria 473286
32 Ga0415639_037935 3300038395 Bacteria 5889
33 Ga0466694_269913 3300042594 Bacteria 2615
34 Ga0466706_191400 3300042599 Bacteria 38914
35 Ga0123355_10140569 3300009826 Bacteria 3695
36 Ga0123355_10374968 3300009826 Bacteria 1860
37 Ga0123353_10521781 3300010167 Bacteria 1723
38 Ga0123353_10557922 3300010167 Bacteria 1650
39 IMNBL1DRAFT_c0000439 3300000062 Bacteria 34888
40 IMNBL1DRAFT_c0008328 3300000062 Bacteria 5292
41 Ga0072940_1136866 3300005200 Bacteria 6378
42 Ga0466711_070230 3300042615 Bacteria 10123
43 Ga0466711_470748 3300042615 Bacteria 1603
44 Ga0466723_061125 3300042618 Bacteria 23742
45 Ga0466704_173547 3300042643 Unclassified 4706
46 Ga0466704_537415 3300042643 Bacteria 9152
47 Ga0160460_100119 3300012845 Unclassified 100006
48 Ga0415639_002710 3300038395 Bacteria 112871
49 Ga0466700_097737 3300042600 Bacteria 42889
50 Ga0466707_139759 3300042601 Bacteria 6240
51 Ga0466714_014223 3300042603 Unclassified 5011
52 Ga0466719_187149 3300042606 Bacteria 13361
53 Ga0466719_513919 3300042606 Bacteria 1628
54 Ga0123356_10001976 3300010049 Unclassified 22176
55 Ga0123353_10635613 3300010167 Unclassified 1515
56 AglaG_contig14211 2084038013 Bacteria 1560
57 Ga0466734_116170 3300042623 Bacteria 6138
58 Ga0466704_460508 3300042643 Bacteria 2131
59 Ga0160446_101218 3300012835 Unclassified 5950
60 Ga0160434_124247 3300012850 Unclassified 901
61 Ga0160448_100112 3300012854 Bacteria 39659
62 Ga0160435_1000168 3300012857 Bacteria 34415
63 Ga0264413_139546 3300024493 Bacteria 7861
64 Ga0415639_003541 3300038395 Unclassified 32696
65 Ga0415639_007187 3300038395 Bacteria 65568
66 Ga0415639_028875 3300038395 Bacteria 12597
67 Ga0415639_213128 3300038395 Bacteria 1949
68 Ga0466690_147069 3300042590 Bacteria 2369
69 Ga0466690_392135 3300042590 Unclassified 4587
70 Ga0466696_456821 3300042596 Bacteria 9077
71 Ga0466714_167642 3300042603 Bacteria 1548
72 Ga0123357_10134293 3300009784 Bacteria 3066
73 Ga0123355_10098456 3300009826 Bacteria 4612
74 Ga0123355_10467039 3300009826 Bacteria 1579
75 Ga0123356_10191408 3300010049 Bacteria 2077
76 Ga0123356_10691366 3300010049 Bacteria 1189
77 JGI24702J35022_10020032 3300002462 Bacteria 3635
78 Ga0466710_123865 3300042613 Bacteria 2046
79 Ga0466726_268767 3300042619 Bacteria 1063
80 Ga0466703_195258 3300042636 Unclassified 9956
81 Ga0160440_100036 3300012815 Bacteria 212163
82 Ga0160468_100014 3300012819 Bacteria 337370
83 Ga0160460_103571 3300012845 Unclassified 2697
84 Ga0160436_1000387 3300012861 Bacteria 18358
85 Ga0466701_043591 3300042598 Bacteria 136062
86 Ga0466706_113727 3300042599 Bacteria 10572
87 Ga0466707_307245 3300042601 Bacteria 4814
88 Ga0466722_026750 3300042609 Bacteria 12487
89 Ga0466698_484736 3300042610 Bacteria 74014
90 Ga0123356_10000004 3300010049 Bacteria 279505
91 Ga0123353_10540848 3300010167 Bacteria 1683
92 Ga0123354_10218294 3300010882 Bacteria 2035
93 2227100264 2225789004 Bacteria 9598
94 2227468797 2225789004 Bacteria 4992
95 Ga0072941_1199212 3300005201 Unclassified 4424
96 Ga0466704_144161 3300042643 Bacteria 9547
97 Ga0466708_202565 3300042652 Bacteria 9160
98 Ga0415639_016409 3300038395 Bacteria 11228
99 Ga0415639_134060 3300038395 Bacteria 1981
100 Ga0466657_079224 3300042582 Bacteria 2800
101 Ga0466694_013756 3300042594 Bacteria 1077
102 Ga0466714_020879 3300042603 Bacteria 19595
103 Ga0466714_051330 3300042603 Bacteria 34645
104 Ga0123356_10032866 3300010049 Bacteria 4852
105 Ga0123356_10059071 3300010049 Bacteria 3577
106 Ga0123356_10143220 3300010049 Bacteria 2361
107 Ga0123353_10143386 3300010167 Bacteria 3824
108 Ga0123353_10190501 3300010167 Bacteria 3238
109 AustNasuHG_c1000666 3300000089 Bacteria 12208
110 Ga0466710_082703 3300042613 Bacteria 7378
111 Ga0466723_075173 3300042618 Bacteria 100663
112 Ga0466726_202831 3300042619 Bacteria 29890
113 Ga0466705_324574 3300042612 Unclassified 2417
114 Ga0466733_071974 3300042659 Bacteria 4873
115 Ga0466729_252457 3300042621 Bacteria 3789
116 Ga0466724_15911 3300042649 Unclassified 15041
117 Ga0160469_100016 3300012824 Bacteria 368306
118 Ga0160433_100648 3300012846 Bacteria 13907
119 Ga0466657_064791 3300042582 Bacteria 17464
120 Ga0466706_131602 3300042599 Unclassified 1242
121 Ga0466714_082025 3300042603 Bacteria 2651
122 Ga0123356_10002553 3300010049 Bacteria 19449
123 Ga0123353_10000072 3300010167 Bacteria 110004
124 Ga0123353_10000210 3300010167 Bacteria 74209
125 Ga0123353_10400987 3300010167 Bacteria 2041
126 2227671816 2225789004 Bacteria 10201
127 Ga0072941_1049497 3300005201 Bacteria 4299
128 Ga0105005_1280275 3300007505 Bacteria 2072
129 Ga0466715_184305 3300042616 Bacteria 16215
130 Ga0466723_069866 3300042618 Bacteria 4171

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 27 175 0.9

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.