Protein Family IF06499
Metagenome
Metatranscriptome
Isolate
321
Members
142
Samples
238
Scaffolds
233.84
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_157517|Ga0466719_157517_594_1409
- Length
- 271 aa
- Sequence
- MGPAAEQRKITRSAATGAHAPEAEDANDTGSRCIMPKHGKKFRSAVAGKDLQRRLSIEEAVAESLSSSYAGFDESVDLALGLGVEPKYSDQMVRGACPLPHGLGKTVRVAVFCKGEKEAEAKAAGADVTGAEELVAKVKEGFLEFDAAIATPDVMALVGQIGRVLGPRGLMPNAKTGTVTFDVAGAVREIKAGRVEFKVDKAGVLHVPLGKVSFGTEKILDNLRALLAEVNRLKPSAAKGAYMKSMALSTTMGPGFKVDPTLIRKFIEGNA
Sample Types
Isolate
25.9%
Metagenome
73.8%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
42.4%
Termitidae
19.4%
Unclassified
14.4%
Kalotermitidae
10.1%
Rhinotermitidae
2.9%
Termopsidae
2.9%
Passalidae
1.4%
Culicidae
1.4%
Largidae
1.4%
Alydidae
1.4%
Berytidae
0.7%
Formicidae
0.7%
Hodotermitidae
0.7%
Taxonomy
Archaea
0
Bacteria
296
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 3 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 6 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 7 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 8 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 9 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 10 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 11 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 12 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 13 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 14 | 2820008971 | Unclassified Synergistetes Lab288P3bin103 | Isolate | Unclassified |
| 15 | 2820058318 | Unclassified Proteobacteria Nt197P4bin33 | Isolate | Unclassified |
| 16 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 17 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 18 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 19 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 20 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 21 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 22 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 23 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 24 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 25 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 39 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 40 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 41 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 42 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 43 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 44 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 45 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 46 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 47 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 48 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 49 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 50 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 51 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 56 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 57 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 58 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 59 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 60 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 61 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 62 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 63 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 64 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 65 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 66 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 67 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 68 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 69 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 70 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 72 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 73 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 74 | 2820070515 | Unclassified Proteobacteria Nt197P3bin137 | Isolate | Unclassified |
| 75 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 76 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 77 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 78 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 79 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 80 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 81 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 82 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 83 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 84 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 85 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 86 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 87 | 2819999932 | Unclassified Synergistetes Th196P4bin51 | Isolate | Unclassified |
| 88 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 89 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 90 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 91 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 92 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 93 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 94 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 95 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 96 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 97 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 98 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 99 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 100 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 101 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 102 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 103 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 104 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 105 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 106 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 107 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 108 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 109 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 110 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 111 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 112 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 113 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 114 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 115 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 116 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 117 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 118 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 119 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 120 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 121 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 122 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 123 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 124 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 125 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 126 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 127 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 128 | 2820916033 | Unclassified Actinobacteria Emb289P3bin63 | Isolate | Unclassified |
| 129 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 130 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 131 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 132 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 133 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 134 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 135 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 136 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 137 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 138 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 139 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 140 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 141 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 142 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10209233 | 3300009784 | Bacteria | 2197 |
| 2 | Ga0123355_10042955 | 3300009826 | Bacteria | 7355 |
| 3 | Ga0466707_196488 | 3300042601 | Bacteria | 11683 |
| 4 | Ga0466717_024755 | 3300042604 | Bacteria | 1776 |
| 5 | Ga0466722_070296 | 3300042609 | Bacteria | 18781 |
| 6 | Ga0466697_053368 | 3300042611 | Bacteria | 2556 |
| 7 | IMNBGM34_c000508 | 3300000036 | Bacteria | 10345 |
| 8 | Ga0466705_138520 | 3300042612 | Unclassified | 1427 |
| 9 | Ga0466731_025704 | 3300042622 | Bacteria | 11770 |
| 10 | Ga0466735_044871 | 3300042624 | Bacteria | 18053 |
| 11 | Ga0466703_059314 | 3300042636 | Bacteria | 22828 |
| 12 | Ga0466703_162466 | 3300042636 | Bacteria | 21407 |
| 13 | Ga0466703_262111 | 3300042636 | Bacteria | 9346 |
| 14 | Ga0466704_214471 | 3300042643 | Bacteria | 2143 |
| 15 | Ga0466709_078906 | 3300042648 | Bacteria | 10892 |
| 16 | Ga0466711_090993 | 3300042615 | Bacteria | 4242 |
| 17 | Ga0466711_116124 | 3300042615 | Bacteria | 9975 |
| 18 | Ga0466711_347084 | 3300042615 | Bacteria | 2339 |
| 19 | Ga0466715_356273 | 3300042616 | Bacteria | 5566 |
| 20 | Ga0466715_604631 | 3300042616 | Bacteria | 7240 |
| 21 | Ga0466718_163829 | 3300042617 | Bacteria | 5342 |
| 22 | Ga0466726_124852 | 3300042619 | Bacteria | 79186 |
| 23 | Ga0466726_449585 | 3300042619 | Bacteria | 4545 |
| 24 | Ga0264413_152389 | 3300024493 | Bacteria | 3508 |
| 25 | Ga0466690_060584 | 3300042590 | Bacteria | 5464 |
| 26 | Ga0466692_029625 | 3300042591 | Bacteria | 2919 |
| 27 | Ga0466692_195905 | 3300042591 | Bacteria | 6901 |
| 28 | Ga0466694_142981 | 3300042594 | Bacteria | 3106 |
| 29 | Ga0466696_167469 | 3300042596 | Bacteria | 11721 |
| 30 | Ga0466696_474197 | 3300042596 | Bacteria | 4699 |
| 31 | Ga0123353_10002061 | 3300010167 | Bacteria | 24829 |
| 32 | Ga0466700_329616 | 3300042600 | Bacteria | 2823 |
| 33 | Ga0466717_026742 | 3300042604 | Bacteria | 1927 |
| 34 | Ga0466716_506413 | 3300042605 | Bacteria | 11245 |
| 35 | Ga0466719_570990 | 3300042606 | Unclassified | 2374 |
| 36 | Ga0466722_179877 | 3300042609 | Bacteria | 16667 |
| 37 | Ga0466705_013926 | 3300042612 | Bacteria | 17289 |
| 38 | Ga0466705_139440 | 3300042612 | Bacteria | 13706 |
| 39 | Ga0466703_010685 | 3300042636 | Bacteria | 3508 |
| 40 | Ga0466703_138211 | 3300042636 | Bacteria | 1772 |
| 41 | Ga0466725_007764 | 3300042654 | Bacteria | 15372 |
| 42 | Ga0466710_196985 | 3300042613 | Bacteria | 2471 |
| 43 | Ga0466710_229356 | 3300042613 | Bacteria | 1096 |
| 44 | Ga0466711_404612 | 3300042615 | Bacteria | 4922 |
| 45 | Ga0466715_025300 | 3300042616 | Unclassified | 14834 |
| 46 | Ga0466715_153198 | 3300042616 | Bacteria | 1943 |
| 47 | Ga0466715_304448 | 3300042616 | Bacteria | 4777 |
| 48 | Ga0466715_338866 | 3300042616 | Bacteria | 4994 |
| 49 | Ga0466723_060140 | 3300042618 | Bacteria | 1863 |
| 50 | Ga0466723_256764 | 3300042618 | Bacteria | 27733 |
| 51 | Ga0466726_118993 | 3300042619 | Bacteria | 12177 |
| 52 | Ga0466726_305285 | 3300042619 | Bacteria | 4160 |
| 53 | Ga0466726_338996 | 3300042619 | Bacteria | 5681 |
| 54 | Ga0160440_100376 | 3300012815 | Bacteria | 18225 |
| 55 | Ga0160459_102314 | 3300012831 | Unclassified | 3194 |
| 56 | Ga0466657_281442 | 3300042582 | Bacteria | 2129 |
| 57 | Ga0466692_067346 | 3300042591 | Bacteria | 15619 |
| 58 | Ga0466691_018487 | 3300042593 | Bacteria | 80759 |
| 59 | Ga0466694_332545 | 3300042594 | Bacteria | 1984 |
| 60 | Ga0466695_040425 | 3300042595 | Bacteria | 7890 |
| 61 | Ga0466733_141957 | 3300042659 | Bacteria | 10292 |
| 62 | Ga0123353_10557411 | 3300010167 | Unclassified | 1651 |
| 63 | Ga0123353_11085389 | 3300010167 | Unclassified | 1065 |
| 64 | Ga0466700_059905 | 3300042600 | Bacteria | 4707 |
| 65 | Ga0466713_109379 | 3300042602 | Bacteria | 40861 |
| 66 | Ga0466716_355696 | 3300042605 | Bacteria | 6328 |
| 67 | Ga0466722_053424 | 3300042609 | Bacteria | 1170 |
| 68 | Ga0466722_076716 | 3300042609 | Bacteria | 3304 |
| 69 | Ga0072941_1209949 | 3300005201 | Bacteria | 4643 |
| 70 | Ga0103268_1029772 | 3300007192 | Bacteria | 1284 |
| 71 | Ga0466729_211224 | 3300042621 | Bacteria | 39520 |
| 72 | Ga0466735_088670 | 3300042624 | Bacteria | 3931 |
| 73 | Ga0466702_392107 | 3300042635 | Bacteria | 1489 |
| 74 | Ga0466703_374126 | 3300042636 | Bacteria | 5737 |
| 75 | Ga0466704_294078 | 3300042643 | Bacteria | 1422 |
| 76 | Ga0466708_323940 | 3300042652 | Bacteria | 18001 |
| 77 | Ga0466727_224521 | 3300042655 | Bacteria | 4128 |
| 78 | Ga0466710_153148 | 3300042613 | Bacteria | 1510 |
| 79 | Ga0466711_168400 | 3300042615 | Unclassified | 2785 |
| 80 | Ga0466711_218509 | 3300042615 | Bacteria | 19081 |
| 81 | Ga0466715_520179 | 3300042616 | Bacteria | 9946 |
| 82 | Ga0466723_126068 | 3300042618 | Bacteria | 9400 |
| 83 | Ga0466728_021214 | 3300042620 | Bacteria | 1498 |
| 84 | Ga0466728_064550 | 3300042620 | Bacteria | 23023 |
| 85 | Ga0466728_271492 | 3300042620 | Bacteria | 2865 |
| 86 | Ga0466690_200933 | 3300042590 | Bacteria | 20078 |
| 87 | Ga0123356_11530727 | 3300010049 | Bacteria | 824 |
| 88 | Ga0123353_10278919 | 3300010167 | Bacteria | 2568 |
| 89 | Ga0123353_10728449 | 3300010167 | Bacteria | 1385 |
| 90 | Ga0466701_028272 | 3300042598 | Bacteria | 2402 |
| 91 | Ga0466700_137495 | 3300042600 | Bacteria | 1230 |
| 92 | Ga0466713_129586 | 3300042602 | Bacteria | 40082 |
| 93 | Ga0466716_027142 | 3300042605 | Bacteria | 21676 |
| 94 | Ga0466719_157517 | 3300042606 | Bacteria | 2668 |
| 95 | Ga0466719_261631 | 3300042606 | Bacteria | 1609 |
| 96 | Ga0466698_098628 | 3300042610 | Bacteria | 3398 |
| 97 | Ga0466698_105230 | 3300042610 | Unclassified | 1187 |
| 98 | JGI24705J35276_12236316 | 3300002504 | Bacteria | 7818 |
| 99 | Ga0072940_1291368 | 3300005200 | Unclassified | 1077 |
| 100 | Ga0466705_007008 | 3300042612 | Bacteria | 1598 |
| 101 | Ga0466705_309277 | 3300042612 | Bacteria | 2548 |
| 102 | Ga0466708_364329 | 3300042652 | Bacteria | 54307 |
| 103 | Ga0466708_439833 | 3300042652 | Bacteria | 4199 |
| 104 | Ga0466705_424260 | 3300042612 | Bacteria | 2845 |
| 105 | Ga0466711_183040 | 3300042615 | Bacteria | 2948 |
| 106 | Ga0466711_355004 | 3300042615 | Bacteria | 4660 |
| 107 | Ga0466715_002439 | 3300042616 | Bacteria | 7834 |
| 108 | Ga0466715_160809 | 3300042616 | Bacteria | 4174 |
| 109 | Ga0466715_458123 | 3300042616 | Bacteria | 3362 |
| 110 | Ga0466715_576135 | 3300042616 | Bacteria | 16833 |
| 111 | Ga0466723_022144 | 3300042618 | Bacteria | 1297 |
| 112 | Ga0466723_203571 | 3300042618 | Bacteria | 7357 |
| 113 | Ga0466723_228377 | 3300042618 | Bacteria | 3057 |
| 114 | Ga0466723_251582 | 3300042618 | Bacteria | 1242 |
| 115 | Ga0466723_352766 | 3300042618 | Bacteria | 1278 |
| 116 | Ga0415639_006388 | 3300038395 | Unclassified | 2164 |
| 117 | Ga0466691_033020 | 3300042593 | Bacteria | 12694 |
| 118 | Ga0466733_182659 | 3300042659 | Bacteria | 183103 |
| 119 | Ga0123356_10015568 | 3300010049 | Unclassified | 7284 |
| 120 | Ga0123353_10029837 | 3300010167 | Unclassified | 8413 |
| 121 | Ga0466701_031276 | 3300042598 | Bacteria | 18234 |
| 122 | Ga0466707_373711 | 3300042601 | Bacteria | 1676 |
| 123 | Ga0466713_043758 | 3300042602 | Bacteria | 37159 |
| 124 | Ga0466716_200811 | 3300042605 | Bacteria | 15529 |
| 125 | Ga0466698_254283 | 3300042610 | Unclassified | 2185 |
| 126 | IMNBGM34_c006014 | 3300000036 | Bacteria | 1587 |
| 127 | JGI24703J35330_11748553 | 3300002501 | Bacteria | 19725 |
| 128 | Ga0072941_1286680 | 3300005201 | Bacteria | 2769 |
| 129 | Ga0466705_290326 | 3300042612 | Unclassified | 6154 |
| 130 | Ga0466703_028570 | 3300042636 | Bacteria | 3199 |
| 131 | Ga0466703_057556 | 3300042636 | Unclassified | 2515 |
| 132 | Ga0466703_295835 | 3300042636 | Bacteria | 5609 |
| 133 | Ga0466708_313628 | 3300042652 | Bacteria | 6126 |
| 134 | Ga0466725_449070 | 3300042654 | Bacteria | 3387 |
| 135 | Ga0466727_011289 | 3300042655 | Bacteria | 2872 |
| 136 | Ga0466711_032192 | 3300042615 | Bacteria | 26652 |
| 137 | Ga0466711_322030 | 3300042615 | Bacteria | 2074 |
| 138 | Ga0466723_292549 | 3300042618 | Bacteria | 8877 |
| 139 | Ga0466723_310851 | 3300042618 | Bacteria | 4978 |
| 140 | Ga0466729_155944 | 3300042621 | Bacteria | 3962 |
| 141 | Ga0466691_037054 | 3300042593 | Bacteria | 9805 |
| 142 | Ga0466691_089260 | 3300042593 | Unclassified | 6162 |
| 143 | Ga0123356_10116046 | 3300010049 | Bacteria | 2595 |
| 144 | Ga0466707_387188 | 3300042601 | Bacteria | 8546 |
| 145 | Ga0466707_407293 | 3300042601 | Bacteria | 2919 |
| 146 | Ga0466717_190688 | 3300042604 | Bacteria | 3256 |
| 147 | Ga0466722_073428 | 3300042609 | Bacteria | 10475 |
| 148 | Ga0466722_217090 | 3300042609 | Bacteria | 19098 |
| 149 | JGI24702J35022_10004259 | 3300002462 | Bacteria | 8540 |
| 150 | JGI24705J35276_12234614 | 3300002504 | Unclassified | 5677 |
| 151 | Ga0072940_1020560 | 3300005200 | Unclassified | 17900 |
| 152 | Ga0072941_1471846 | 3300005201 | Bacteria | 2376 |
| 153 | Ga0466705_206897 | 3300042612 | Bacteria | 2445 |
| 154 | Ga0466703_087527 | 3300042636 | Bacteria | 8574 |
| 155 | Ga0466703_130812 | 3300042636 | Bacteria | 6349 |
| 156 | Ga0466703_363173 | 3300042636 | Bacteria | 7440 |
| 157 | Ga0466704_175213 | 3300042643 | Bacteria | 68590 |
| 158 | Ga0466709_061915 | 3300042648 | Bacteria | 20339 |
| 159 | Ga0466708_118129 | 3300042652 | Bacteria | 25475 |
| 160 | Ga0466708_164328 | 3300042652 | Bacteria | 13919 |
| 161 | Ga0466708_241130 | 3300042652 | Bacteria | 3644 |
| 162 | Ga0466708_408047 | 3300042652 | Bacteria | 30845 |
| 163 | Ga0466725_045645 | 3300042654 | Bacteria | 18820 |
| 164 | Ga0466710_444818 | 3300042613 | Bacteria | 7825 |
| 165 | Ga0466711_441446 | 3300042615 | Bacteria | 3302 |
| 166 | Ga0466715_366385 | 3300042616 | Bacteria | 7763 |
| 167 | Ga0466715_558180 | 3300042616 | Bacteria | 2146 |
| 168 | Ga0466715_573674 | 3300042616 | Bacteria | 4663 |
| 169 | Ga0466726_050501 | 3300042619 | Bacteria | 15900 |
| 170 | Ga0223683_1012300 | 3300021245 | Bacteria | 3699 |
| 171 | Ga0415639_092258 | 3300038395 | Bacteria | 5651 |
| 172 | Ga0466690_356350 | 3300042590 | Unclassified | 2009 |
| 173 | Ga0466691_149870 | 3300042593 | Bacteria | 4195 |
| 174 | Ga0466696_031732 | 3300042596 | Bacteria | 1616 |
| 175 | Ga0466696_439522 | 3300042596 | Bacteria | 1216 |
| 176 | Ga0466733_022421 | 3300042659 | Bacteria | 8374 |
| 177 | Ga0123353_10158087 | 3300010167 | Bacteria | 3611 |
| 178 | Ga0123353_10412604 | 3300010167 | Bacteria | 2004 |
| 179 | Ga0160471_103788 | 3300012812 | Unclassified | 2225 |
| 180 | Ga0466706_093768 | 3300042599 | Bacteria | 1076 |
| 181 | Ga0466700_388706 | 3300042600 | Bacteria | 3258 |
| 182 | Ga0466716_430563 | 3300042605 | Bacteria | 11048 |
| 183 | Ga0466719_040056 | 3300042606 | Bacteria | 2562 |
| 184 | JGI24702J35022_10026761 | 3300002462 | Unclassified | 3105 |
| 185 | Ga0466697_242956 | 3300042611 | Bacteria | 3733 |
| 186 | Ga0466705_017437 | 3300042612 | Bacteria | 17644 |
| 187 | Ga0466705_107103 | 3300042612 | Bacteria | 2073 |
| 188 | Ga0466734_110589 | 3300042623 | Bacteria | 1967 |
| 189 | Ga0466704_140451 | 3300042643 | Bacteria | 8289 |
| 190 | Ga0466704_263142 | 3300042643 | Bacteria | 6679 |
| 191 | Ga0466704_309603 | 3300042643 | Bacteria | 23533 |
| 192 | Ga0466704_398191 | 3300042643 | Unclassified | 5465 |
| 193 | Ga0466708_021042 | 3300042652 | Bacteria | 36953 |
| 194 | Ga0466708_097984 | 3300042652 | Bacteria | 5932 |
| 195 | Ga0466708_168140 | 3300042652 | Bacteria | 4122 |
| 196 | Ga0466711_421355 | 3300042615 | Unclassified | 6727 |
| 197 | Ga0466718_021282 | 3300042617 | Bacteria | 3259 |
| 198 | Ga0466723_166148 | 3300042618 | Bacteria | 1966 |
| 199 | Ga0466723_187887 | 3300042618 | Bacteria | 1085 |
| 200 | Ga0466723_297790 | 3300042618 | Bacteria | 19421 |
| 201 | Ga0466723_350590 | 3300042618 | Bacteria | 11181 |
| 202 | Ga0466723_358684 | 3300042618 | Bacteria | 2716 |
| 203 | Ga0466728_117382 | 3300042620 | Bacteria | 1686 |
| 204 | Ga0466657_069866 | 3300042582 | Bacteria | 1784 |
| 205 | Ga0466691_053870 | 3300042593 | Unclassified | 8312 |
| 206 | Ga0466691_077332 | 3300042593 | Bacteria | 2083 |
| 207 | Ga0466691_213774 | 3300042593 | Bacteria | 1568 |
| 208 | Ga0466696_096548 | 3300042596 | Bacteria | 1198 |
| 209 | Ga0466696_204543 | 3300042596 | Bacteria | 2298 |
| 210 | Ga0466699_008574 | 3300042597 | Bacteria | 8119 |
| 211 | Ga0123356_10003991 | 3300010049 | Bacteria | 15330 |
| 212 | Ga0123356_10387415 | 3300010049 | Bacteria | 1532 |
| 213 | Ga0123353_10030156 | 3300010167 | Bacteria | 8375 |
| 214 | Ga0123353_10636639 | 3300010167 | Bacteria | 1513 |
| 215 | Ga0466713_097467 | 3300042602 | Bacteria | 3813 |
| 216 | Ga0466719_270187 | 3300042606 | Bacteria | 1542 |
| 217 | Ga0466722_034978 | 3300042609 | Bacteria | 8342 |
| 218 | Ga0466722_046512 | 3300042609 | Bacteria | 16580 |
| 219 | Ga0466698_068027 | 3300042610 | Bacteria | 1266 |
| 220 | 2227127470 | 2225789004 | Bacteria | 1674 |
| 221 | Ga0068302_10023954 | 3300005071 | Bacteria | 3598 |
| 222 | Ga0466705_249934 | 3300042612 | Bacteria | 4139 |
| 223 | Ga0466735_058049 | 3300042624 | Bacteria | 2943 |
| 224 | Ga0466703_384516 | 3300042636 | Bacteria | 9350 |
| 225 | Ga0466703_420055 | 3300042636 | Unclassified | 1518 |
| 226 | Ga0466704_027569 | 3300042643 | Bacteria | 2101 |
| 227 | Ga0466704_513012 | 3300042643 | Bacteria | 21987 |
| 228 | Ga0466711_029711 | 3300042615 | Bacteria | 4400 |
| 229 | Ga0466711_080340 | 3300042615 | Bacteria | 24032 |
| 230 | Ga0466711_149114 | 3300042615 | Bacteria | 1056 |
| 231 | Ga0466711_495378 | 3300042615 | Bacteria | 3533 |
| 232 | Ga0466715_099310 | 3300042616 | Bacteria | 20026 |
| 233 | Ga0466715_123583 | 3300042616 | Bacteria | 60701 |
| 234 | Ga0466715_124771 | 3300042616 | Bacteria | 37712 |
| 235 | Ga0466715_353489 | 3300042616 | Bacteria | 21802 |
| 236 | Ga0466656_098067 | 3300042550 | Bacteria | 1625 |
| 237 | Ga0466694_208886 | 3300042594 | Bacteria | 5697 |
| 238 | Ga0466694_212050 | 3300042594 | Bacteria | 7321 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00687 | Ribosomal_L1 | Ribosomal protein L1p/L10e family | 67 | 254 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.