Protein Family IF06480
Metagenome
Isolate
200
Members
59
Samples
195
Scaffolds
131.84
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_108955|Ga0466719_108955_1364_1804
- Length
- 146 aa
- Sequence
- MIGLIDVCGAMEILLQKEKADKFGTILQEAELIIAPDLYISELTNTLWKYHRAHILTKDECIQYIQDGINYVDKFIDSKELWQEAFSEGINNDHSIYDMFYMVAARRNNGILITNDSVLAAICKKNNVQICEAVPKLQFIEREKLT
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
57.1%
Kalotermitidae
19.6%
Unclassified
12.5%
Termopsidae
7.1%
Rhinotermitidae
3.6%
Taxonomy
Archaea
0
Bacteria
185
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 38 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 39 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 45 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 46 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 47 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 48 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 49 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 50 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 51 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 52 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 54 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 55 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 56 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 57 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 58 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 59 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_067070 | 3300042656 | Bacteria | 1866 |
| 2 | Ga0466733_027058 | 3300042659 | Bacteria | 1174 |
| 3 | Ga0466733_215351 | 3300042659 | Bacteria | 20341 |
| 4 | Ga0466707_172651 | 3300042601 | Bacteria | 1267 |
| 5 | Ga0466719_108955 | 3300042606 | Bacteria | 41298 |
| 6 | Ga0466719_223073 | 3300042606 | Bacteria | 35730 |
| 7 | Ga0466720_178610 | 3300042607 | Bacteria | 15016 |
| 8 | Ga0466722_006420 | 3300042609 | Bacteria | 1324 |
| 9 | Ga0466712_105088 | 3300042614 | Unclassified | 2809 |
| 10 | Ga0466712_306776 | 3300042614 | Bacteria | 1001 |
| 11 | Ga0466715_026092 | 3300042616 | Bacteria | 2728 |
| 12 | Ga0466718_006047 | 3300042617 | Bacteria | 3438 |
| 13 | Ga0466718_120709 | 3300042617 | Bacteria | 1615 |
| 14 | Ga0466723_351856 | 3300042618 | Bacteria | 3220 |
| 15 | Ga0466726_088507 | 3300042619 | Bacteria | 3079 |
| 16 | Ga0466728_050157 | 3300042620 | Bacteria | 2257 |
| 17 | Ga0123357_10800941 | 3300009784 | Bacteria | 638 |
| 18 | Ga0123355_10168656 | 3300009826 | Bacteria | 3278 |
| 19 | Ga0123356_11178463 | 3300010049 | Bacteria | 933 |
| 20 | Ga0123356_12983239 | 3300010049 | Bacteria | 591 |
| 21 | Ga0123353_13276812 | 3300010167 | Bacteria | 517 |
| 22 | Ga0466697_070760 | 3300042611 | Bacteria | 2361 |
| 23 | Ga0466735_005578 | 3300042624 | Bacteria | 1647 |
| 24 | Ga0466735_139214 | 3300042624 | Bacteria | 1738 |
| 25 | Ga0466703_039803 | 3300042636 | Bacteria | 4162 |
| 26 | Ga0466703_158797 | 3300042636 | Bacteria | 1167 |
| 27 | Ga0466704_586450 | 3300042643 | Bacteria | 1368 |
| 28 | Ga0466709_272539 | 3300042648 | Bacteria | 1079 |
| 29 | Ga0466708_028501 | 3300042652 | Bacteria | 1130 |
| 30 | Ga0466708_072985 | 3300042652 | Bacteria | 1208 |
| 31 | Ga0466708_095567 | 3300042652 | Bacteria | 3449 |
| 32 | Ga0466708_404619 | 3300042652 | Bacteria | 19414 |
| 33 | Ga0466727_127922 | 3300042655 | Bacteria | 28844 |
| 34 | JGI24698J34947_10018130 | 3300002449 | Bacteria | 3809 |
| 35 | JGI24698J34947_10120971 | 3300002449 | Unclassified | 1136 |
| 36 | JGI24695J34938_10261091 | 3300002450 | Bacteria | 738 |
| 37 | Ga0466732_005483 | 3300042656 | Bacteria | 9382 |
| 38 | Ga0466732_135912 | 3300042656 | Bacteria | 1354 |
| 39 | Ga0466732_273265 | 3300042656 | Bacteria | 18937 |
| 40 | Ga0466700_384644 | 3300042600 | Bacteria | 1040 |
| 41 | Ga0466717_251463 | 3300042604 | Bacteria | 1218 |
| 42 | Ga0466720_162856 | 3300042607 | Bacteria | 2431 |
| 43 | Ga0466712_081724 | 3300042614 | Bacteria | 6731 |
| 44 | Ga0466715_157835 | 3300042616 | Bacteria | 25572 |
| 45 | Ga0466715_214167 | 3300042616 | Bacteria | 1634 |
| 46 | Ga0466715_249691 | 3300042616 | Bacteria | 9644 |
| 47 | Ga0466728_480001 | 3300042620 | Bacteria | 1600 |
| 48 | Ga0466729_052328 | 3300042621 | Bacteria | 3019 |
| 49 | Ga0123356_10267329 | 3300010049 | Bacteria | 1798 |
| 50 | Ga0123356_11553163 | 3300010049 | Bacteria | 818 |
| 51 | Ga0123356_13266926 | 3300010049 | Bacteria | 564 |
| 52 | Ga0466735_077229 | 3300042624 | Unclassified | 2088 |
| 53 | Ga0466735_182789 | 3300042624 | Bacteria | 1696 |
| 54 | Ga0466702_215742 | 3300042635 | Bacteria | 1155 |
| 55 | Ga0466703_051474 | 3300042636 | Bacteria | 5396 |
| 56 | Ga0466704_373013 | 3300042643 | Unclassified | 7980 |
| 57 | Ga0466708_123939 | 3300042652 | Bacteria | 1130 |
| 58 | Ga0466693_343527 | 3300042592 | Unclassified | 1175 |
| 59 | Ga0466699_048304 | 3300042597 | Bacteria | 1092 |
| 60 | Nasutiter_FTJKGMZ01DLPH9 | 2030936001 | Unclassified | 512 |
| 61 | AustNasuHG_c1014715 | 3300000089 | Unclassified | 2652 |
| 62 | JGI24698J34947_10065390 | 3300002449 | Unclassified | 1773 |
| 63 | JGI24695J34938_10011406 | 3300002450 | Bacteria | 4789 |
| 64 | Ga0072940_1089918 | 3300005200 | Bacteria | 759 |
| 65 | Ga0074263_119051 | 3300005485 | Bacteria | 832 |
| 66 | Ga0466732_148452 | 3300042656 | Bacteria | 1607 |
| 67 | Ga0466707_320435 | 3300042601 | Bacteria | 3337 |
| 68 | Ga0466714_150329 | 3300042603 | Bacteria | 3010 |
| 69 | Ga0466719_483934 | 3300042606 | Bacteria | 1681 |
| 70 | Ga0466720_071060 | 3300042607 | Bacteria | 1746 |
| 71 | Ga0466698_011176 | 3300042610 | Bacteria | 17753 |
| 72 | Ga0466712_011725 | 3300042614 | Unclassified | 1677 |
| 73 | Ga0466712_017121 | 3300042614 | Bacteria | 19701 |
| 74 | Ga0466718_015513 | 3300042617 | Bacteria | 5971 |
| 75 | Ga0466726_114529 | 3300042619 | Bacteria | 1070 |
| 76 | Ga0123355_11464736 | 3300009826 | Bacteria | 669 |
| 77 | Ga0466729_257952 | 3300042621 | Bacteria | 2778 |
| 78 | Ga0466729_274555 | 3300042621 | Bacteria | 1734 |
| 79 | Ga0466735_005865 | 3300042624 | Bacteria | 1209 |
| 80 | Ga0466735_166048 | 3300042624 | Unclassified | 3923 |
| 81 | Ga0466704_058534 | 3300042643 | Bacteria | 1589 |
| 82 | Ga0466708_305552 | 3300042652 | Bacteria | 2247 |
| 83 | Ga0466690_153698 | 3300042590 | Bacteria | 2111 |
| 84 | Ga0466690_416362 | 3300042590 | Bacteria | 1064 |
| 85 | Ga0466690_431558 | 3300042590 | Bacteria | 1511 |
| 86 | Ga0466699_065422 | 3300042597 | Bacteria | 2850 |
| 87 | JGI24696J40584_12621350 | 3300002834 | Bacteria | 671 |
| 88 | Ga0072941_1451602 | 3300005201 | Bacteria | 584 |
| 89 | Ga0466733_041225 | 3300042659 | Bacteria | 1429 |
| 90 | Ga0466719_321689 | 3300042606 | Bacteria | 12172 |
| 91 | Ga0466720_082406 | 3300042607 | Bacteria | 20211 |
| 92 | Ga0466705_446919 | 3300042612 | Bacteria | 4611 |
| 93 | Ga0466718_093808 | 3300042617 | Unclassified | 2575 |
| 94 | Ga0466726_159830 | 3300042619 | Bacteria | 6417 |
| 95 | Ga0123357_10054043 | 3300009784 | Bacteria | 5417 |
| 96 | Ga0123356_10101418 | 3300010049 | Bacteria | 2762 |
| 97 | Ga0123356_10451109 | 3300010049 | Bacteria | 1434 |
| 98 | Ga0123353_10304988 | 3300010167 | Bacteria | 2428 |
| 99 | Ga0123353_11938538 | 3300010167 | Bacteria | 725 |
| 100 | Ga0123353_11989652 | 3300010167 | Bacteria | 712 |
| 101 | Ga0466702_347363 | 3300042635 | Bacteria | 1489 |
| 102 | Ga0466704_015738 | 3300042643 | Bacteria | 2342 |
| 103 | Ga0466704_219298 | 3300042643 | Bacteria | 6455 |
| 104 | Ga0466727_265504 | 3300042655 | Bacteria | 1286 |
| 105 | Ga0264413_127570 | 3300024493 | Bacteria | 5658 |
| 106 | Ga0466691_047646 | 3300042593 | Bacteria | 4380 |
| 107 | Ga0466699_324992 | 3300042597 | Bacteria | 1300 |
| 108 | FAAS_10365894 | 3300001880 | Bacteria | 520 |
| 109 | JGI24698J34947_10040779 | 3300002449 | Bacteria | 2395 |
| 110 | JGI24695J34938_10488301 | 3300002450 | Bacteria | 561 |
| 111 | Ga0068305_10109090 | 3300005083 | Bacteria | 3142 |
| 112 | Ga0466732_286898 | 3300042656 | Bacteria | 9458 |
| 113 | Ga0466733_203748 | 3300042659 | Bacteria | 5119 |
| 114 | Ga0466707_056049 | 3300042601 | Unclassified | 2583 |
| 115 | Ga0466719_409677 | 3300042606 | Bacteria | 1178 |
| 116 | Ga0466720_196731 | 3300042607 | Unclassified | 1432 |
| 117 | Ga0466712_248065 | 3300042614 | Bacteria | 10133 |
| 118 | Ga0466715_020252 | 3300042616 | Bacteria | 5352 |
| 119 | Ga0466718_020081 | 3300042617 | Bacteria | 6886 |
| 120 | Ga0466726_136871 | 3300042619 | Bacteria | 1628 |
| 121 | Ga0466728_019946 | 3300042620 | Bacteria | 7654 |
| 122 | Ga0466728_347710 | 3300042620 | Bacteria | 42490 |
| 123 | Ga0123356_10925623 | 3300010049 | Bacteria | 1043 |
| 124 | Ga0123353_10210510 | 3300010167 | Bacteria | 3050 |
| 125 | Ga0466708_253409 | 3300042652 | Bacteria | 1038 |
| 126 | Ga0466727_082586 | 3300042655 | Bacteria | 1133 |
| 127 | Ga0466695_020213 | 3300042595 | Bacteria | 1088 |
| 128 | Ga0466699_029399 | 3300042597 | Bacteria | 27869 |
| 129 | JGI24698J34947_10065387 | 3300002449 | Bacteria | 1773 |
| 130 | Ga0072941_1015315 | 3300005201 | Bacteria | 6875 |
| 131 | Ga0466701_086026 | 3300042598 | Bacteria | 1484 |
| 132 | Ga0466707_307904 | 3300042601 | Bacteria | 1176 |
| 133 | Ga0466719_096888 | 3300042606 | Bacteria | 1337 |
| 134 | Ga0466719_345032 | 3300042606 | Bacteria | 1887 |
| 135 | Ga0466720_220414 | 3300042607 | Bacteria | 1532 |
| 136 | Ga0466722_162210 | 3300042609 | Bacteria | 1819 |
| 137 | Ga0466698_263470 | 3300042610 | Bacteria | 2548 |
| 138 | Ga0466715_328329 | 3300042616 | Bacteria | 1917 |
| 139 | Ga0466718_088451 | 3300042617 | Bacteria | 1248 |
| 140 | Ga0466718_152636 | 3300042617 | Bacteria | 3360 |
| 141 | Ga0466723_049628 | 3300042618 | Bacteria | 11656 |
| 142 | Ga0466726_403792 | 3300042619 | Bacteria | 3323 |
| 143 | Ga0466697_178934 | 3300042611 | Bacteria | 2175 |
| 144 | Ga0466705_121274 | 3300042612 | Bacteria | 2174 |
| 145 | Ga0466705_261867 | 3300042612 | Bacteria | 4190 |
| 146 | Ga0466704_063273 | 3300042643 | Bacteria | 4539 |
| 147 | Ga0466709_147971 | 3300042648 | Bacteria | 1702 |
| 148 | Ga0466727_319151 | 3300042655 | Bacteria | 4448 |
| 149 | Ga0466656_169052 | 3300042550 | Bacteria | 1084 |
| 150 | Ga0466691_146930 | 3300042593 | Bacteria | 22116 |
| 151 | Ga0466694_297565 | 3300042594 | Bacteria | 1307 |
| 152 | JGI24699J35502_11132945 | 3300002509 | Bacteria | 8068 |
| 153 | Ga0072941_1315125 | 3300005201 | Bacteria | 929 |
| 154 | Ga0466707_327076 | 3300042601 | Bacteria | 1185 |
| 155 | Ga0466720_004995 | 3300042607 | Bacteria | 2717 |
| 156 | Ga0466720_019050 | 3300042607 | Bacteria | 2165 |
| 157 | Ga0466698_232792 | 3300042610 | Bacteria | 1856 |
| 158 | Ga0466698_344392 | 3300042610 | Bacteria | 1031 |
| 159 | Ga0466723_219021 | 3300042618 | Bacteria | 1130 |
| 160 | Ga0466726_144398 | 3300042619 | Bacteria | 2314 |
| 161 | Ga0123356_11635196 | 3300010049 | Bacteria | 798 |
| 162 | Ga0466705_155239 | 3300042612 | Bacteria | 1136 |
| 163 | Ga0466703_106621 | 3300042636 | Bacteria | 11198 |
| 164 | Ga0466704_417263 | 3300042643 | Bacteria | 2149 |
| 165 | Ga0466704_440738 | 3300042643 | Bacteria | 2391 |
| 166 | Ga0466708_229813 | 3300042652 | Bacteria | 1702 |
| 167 | Ga0466691_013726 | 3300042593 | Bacteria | 8812 |
| 168 | Ga0466699_293721 | 3300042597 | Bacteria | 1394 |
| 169 | JGI24698J34947_10003332 | 3300002449 | Bacteria | 8715 |
| 170 | JGI24695J34938_10078753 | 3300002450 | Bacteria | 1364 |
| 171 | Ga0466707_301297 | 3300042601 | Bacteria | 1274 |
| 172 | Ga0466698_063355 | 3300042610 | Bacteria | 1572 |
| 173 | Ga0466712_316879 | 3300042614 | Bacteria | 1090 |
| 174 | Ga0466715_550300 | 3300042616 | Bacteria | 3886 |
| 175 | Ga0466723_108240 | 3300042618 | Bacteria | 28572 |
| 176 | Ga0123355_10206656 | 3300009826 | Bacteria | 2855 |
| 177 | Ga0123354_10158477 | 3300010882 | Bacteria | 2701 |
| 178 | Ga0466735_160312 | 3300042624 | Bacteria | 1311 |
| 179 | Ga0466703_180539 | 3300042636 | Bacteria | 7197 |
| 180 | Ga0466704_157187 | 3300042643 | Unclassified | 2351 |
| 181 | Ga0466704_175460 | 3300042643 | Bacteria | 1252 |
| 182 | Ga0466704_280963 | 3300042643 | Bacteria | 68260 |
| 183 | Ga0466704_358961 | 3300042643 | Bacteria | 2926 |
| 184 | Ga0466704_420848 | 3300042643 | Bacteria | 3225 |
| 185 | Ga0466708_082101 | 3300042652 | Bacteria | 6650 |
| 186 | Ga0264413_141765 | 3300024493 | Bacteria | 1008 |
| 187 | Ga0415639_246719 | 3300038395 | Bacteria | 3119 |
| 188 | Ga0466690_082475 | 3300042590 | Bacteria | 1280 |
| 189 | Ga0466691_084376 | 3300042593 | Bacteria | 4830 |
| 190 | Ga0466691_160022 | 3300042593 | Bacteria | 3514 |
| 191 | Ga0466691_223346 | 3300042593 | Bacteria | 1377 |
| 192 | Ga0466699_398437 | 3300042597 | Bacteria | 1180 |
| 193 | JGI24698J34947_10022554 | 3300002449 | Unclassified | 3375 |
| 194 | JGI24702J35022_10045127 | 3300002462 | Bacteria | 2349 |
| 195 | Ga0068302_10167199 | 3300005071 | Bacteria | 1783 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 11 | 124 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.