Protein Family IF06454
Metagenome
Metatranscriptome
Isolate
231
Members
80
Samples
206
Scaffolds
116.87
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_040767|Ga0466719_040767_122580_122966
- Length
- 128 aa
- Sequence
- LNNDENEDFDMRAKSVVYTRQRKKKIFRFAKGSYAAKKNRWRMVVQQAEKSLNYSYTGRKDKKADFRSLWVVRINAAVREEGVSYSKFISGLKRSNIIIDRKMLAEIAVNDKCAFKQLVNVVKNVEQQ
Sample Types
Isolate
10.8%
Metagenome
88.7%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
26.0%
Unclassified
19.5%
Kalotermitidae
18.2%
Elmidae
6.5%
Culicidae
5.2%
Termopsidae
5.2%
Rhinotermitidae
3.9%
Apidae
2.6%
Passalidae
2.6%
Drosophilidae
2.6%
Formicidae
2.6%
Trigoniulidae
1.3%
Hodotermitidae
1.3%
Curculionidae
1.3%
Gryllidae
1.3%
Taxonomy
Archaea
0
Bacteria
202
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 2 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 3 | 2964144231 | Entomospira culicis BR151 | Isolate | Culicidae |
| 4 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 5 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 14 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 15 | 8063595521 | Entomospira culicis BR149 | Isolate | Culicidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 22 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 32 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 40 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 41 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 46 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 47 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 50 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 51 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 54 | 2964145936 | Entomospira culicis BR149 | Isolate | Culicidae |
| 55 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 56 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 57 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 58 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 59 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 60 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 61 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 62 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 63 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 64 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 65 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 66 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 67 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 68 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 69 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 70 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 71 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 72 | 8063597228 | Entomospira culicis BR151 | Isolate | Culicidae |
| 73 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 74 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 75 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 76 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 77 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 78 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 79 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 80 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_072299 | 3300042659 | Unclassified | 1416 |
| 2 | Ga0123357_10680737 | 3300009784 | Bacteria | 747 |
| 3 | Ga0123353_10000752 | 3300010167 | Bacteria | 39322 |
| 4 | Ga0123354_10001202 | 3300010882 | Unclassified | 30549 |
| 5 | Ga0123354_10321940 | 3300010882 | Bacteria | 1425 |
| 6 | Ga0123354_10439070 | 3300010882 | Bacteria | 1068 |
| 7 | Ga0466707_251937 | 3300042601 | Bacteria | 7441 |
| 8 | Ga0466713_058000 | 3300042602 | Bacteria | 28548 |
| 9 | Ga0466713_079335 | 3300042602 | Bacteria | 100418 |
| 10 | Ga0466714_140304 | 3300042603 | Bacteria | 61280 |
| 11 | Ga0466719_435076 | 3300042606 | Bacteria | 2544 |
| 12 | Ga0466722_083289 | 3300042609 | Bacteria | 6083 |
| 13 | JGI24705J35276_12238640 | 3300002504 | Bacteria | 31523 |
| 14 | Ga0068302_10006579 | 3300005071 | Bacteria | 8644 |
| 15 | Ga0068305_10441043 | 3300005083 | Bacteria | 2469 |
| 16 | Ga0466705_208486 | 3300042612 | Bacteria | 71494 |
| 17 | Ga0466735_024859 | 3300042624 | Bacteria | 11405 |
| 18 | Ga0466735_226778 | 3300042624 | Bacteria | 13363 |
| 19 | Ga0466703_008924 | 3300042636 | Bacteria | 2880 |
| 20 | Ga0466726_084867 | 3300042619 | Bacteria | 3084 |
| 21 | Ga0466726_100896 | 3300042619 | Bacteria | 2023 |
| 22 | Ga0466728_184966 | 3300042620 | Bacteria | 2302 |
| 23 | Ga0466729_066529 | 3300042621 | Bacteria | 2352 |
| 24 | Ga0466693_337277 | 3300042592 | Bacteria | 2916 |
| 25 | Ga0466696_010826 | 3300042596 | Bacteria | 7115 |
| 26 | Ga0123355_10041929 | 3300009826 | Bacteria | 7451 |
| 27 | Ga0123355_11353990 | 3300009826 | Bacteria | 708 |
| 28 | Ga0123356_11654412 | 3300010049 | Bacteria | 793 |
| 29 | Ga0123353_10357048 | 3300010167 | Bacteria | 2198 |
| 30 | Ga0123353_11408066 | 3300010167 | Bacteria | 896 |
| 31 | Ga0123354_10023525 | 3300010882 | Bacteria | 9714 |
| 32 | Ga0123354_11037932 | 3300010882 | Bacteria | 525 |
| 33 | Ga0466706_088085 | 3300042599 | Bacteria | 25105 |
| 34 | Ga0466707_127045 | 3300042601 | Bacteria | 82449 |
| 35 | Ga0466707_339432 | 3300042601 | Bacteria | 2030 |
| 36 | Ga0466721_299544 | 3300042608 | Bacteria | 1200 |
| 37 | HBC_ctgsDRAFT_1024392 | 3300000333 | Bacteria | 1483 |
| 38 | Ga0068305_10002157 | 3300005083 | Bacteria | 29005 |
| 39 | Ga0072941_1279758 | 3300005201 | Bacteria | 830 |
| 40 | Ga0102734_1002780 | 3300007129 | Bacteria | 5130 |
| 41 | Ga0466705_186363 | 3300042612 | Unclassified | 4652 |
| 42 | Ga0466734_001270 | 3300042623 | Bacteria | 2653 |
| 43 | Ga0466735_062437 | 3300042624 | Bacteria | 4446 |
| 44 | Ga0466735_063452 | 3300042624 | Bacteria | 2788 |
| 45 | Ga0466735_068443 | 3300042624 | Bacteria | 7967 |
| 46 | Ga0466703_017065 | 3300042636 | Bacteria | 116716 |
| 47 | Ga0466711_056622 | 3300042615 | Bacteria | 4685 |
| 48 | Ga0466723_189592 | 3300042618 | Bacteria | 22485 |
| 49 | Ga0466723_281090 | 3300042618 | Bacteria | 178430 |
| 50 | Ga0466729_155325 | 3300042621 | Bacteria | 11266 |
| 51 | Ga0466690_213741 | 3300042590 | Bacteria | 2538 |
| 52 | Ga0466692_195337 | 3300042591 | Bacteria | 5983 |
| 53 | Ga0466691_144881 | 3300042593 | Bacteria | 142883 |
| 54 | Ga0466691_172704 | 3300042593 | Bacteria | 13832 |
| 55 | Ga0123357_10014946 | 3300009784 | Bacteria | 10157 |
| 56 | Ga0123357_10623887 | 3300009784 | Bacteria | 813 |
| 57 | Ga0123356_10331452 | 3300010049 | Unclassified | 1639 |
| 58 | Ga0123356_12890861 | 3300010049 | Bacteria | 600 |
| 59 | Ga0123354_11061456 | 3300010882 | Bacteria | 517 |
| 60 | Ga0466706_012490 | 3300042599 | Bacteria | 21476 |
| 61 | Ga0466706_019380 | 3300042599 | Bacteria | 325727 |
| 62 | Ga0466706_201378 | 3300042599 | Bacteria | 153801 |
| 63 | Ga0466706_213897 | 3300042599 | Bacteria | 18237 |
| 64 | Ga0466721_145402 | 3300042608 | Bacteria | 36480 |
| 65 | IMNBL1DRAFT_c0006268 | 3300000062 | Bacteria | 6531 |
| 66 | JGI24702J35022_10204022 | 3300002462 | Unclassified | 1133 |
| 67 | Ga0466705_056405 | 3300042612 | Bacteria | 35525 |
| 68 | Ga0466735_026862 | 3300042624 | Bacteria | 5266 |
| 69 | Ga0466735_077136 | 3300042624 | Bacteria | 4676 |
| 70 | Ga0466735_218729 | 3300042624 | Unclassified | 1895 |
| 71 | Ga0466703_094842 | 3300042636 | Bacteria | 32537 |
| 72 | Ga0466704_258530 | 3300042643 | Bacteria | 5676 |
| 73 | Ga0466704_357084 | 3300042643 | Unclassified | 16942 |
| 74 | Ga0466704_387652 | 3300042643 | Bacteria | 2306 |
| 75 | Ga0466727_168534 | 3300042655 | Bacteria | 69590 |
| 76 | Ga0466715_065350 | 3300042616 | Bacteria | 64817 |
| 77 | Ga0466726_156546 | 3300042619 | Bacteria | 7125 |
| 78 | Ga0466726_160240 | 3300042619 | Bacteria | 24068 |
| 79 | Ga0223675_1119248 | 3300021237 | Bacteria | 507 |
| 80 | Ga0466693_008752 | 3300042592 | Unclassified | 1656 |
| 81 | Ga0123353_10012482 | 3300010167 | Bacteria | 12083 |
| 82 | Ga0123353_10609300 | 3300010167 | Bacteria | 1558 |
| 83 | Ga0466706_014994 | 3300042599 | Bacteria | 2513 |
| 84 | Ga0466706_075594 | 3300042599 | Bacteria | 269977 |
| 85 | Ga0466706_189794 | 3300042599 | Bacteria | 3698 |
| 86 | Ga0466713_147232 | 3300042602 | Unclassified | 33095 |
| 87 | Ga0466714_008822 | 3300042603 | Bacteria | 75027 |
| 88 | Ga0466719_040767 | 3300042606 | Bacteria | 242892 |
| 89 | JGI24702J35022_10011397 | 3300002462 | Bacteria | 4954 |
| 90 | JGI24702J35022_10024687 | 3300002462 | Bacteria | 3246 |
| 91 | JGI24705J35276_11908075 | 3300002504 | Bacteria | 757 |
| 92 | Ga0068302_10018813 | 3300005071 | Bacteria | 2607 |
| 93 | Ga0068305_10000168 | 3300005083 | Bacteria | 304006 |
| 94 | Ga0072941_1010562 | 3300005201 | Bacteria | 1775 |
| 95 | Ga0072941_1472088 | 3300005201 | Bacteria | 1242 |
| 96 | Ga0103267_1000043 | 3300007190 | Bacteria | 94946 |
| 97 | Ga0466705_127163 | 3300042612 | Bacteria | 23106 |
| 98 | Ga0466735_160123 | 3300042624 | Bacteria | 1986 |
| 99 | Ga0466735_215172 | 3300042624 | Bacteria | 2481 |
| 100 | Ga0466703_029355 | 3300042636 | Bacteria | 1748 |
| 101 | Ga0466711_032203 | 3300042615 | Bacteria | 19663 |
| 102 | Ga0466715_037823 | 3300042616 | Unclassified | 5436 |
| 103 | Ga0466726_460487 | 3300042619 | Bacteria | 36089 |
| 104 | Ga0466728_053091 | 3300042620 | Bacteria | 22066 |
| 105 | Ga0466728_148483 | 3300042620 | Bacteria | 11058 |
| 106 | Ga0466729_067937 | 3300042621 | Bacteria | 2333 |
| 107 | Ga0415639_008305 | 3300038395 | Bacteria | 51915 |
| 108 | Ga0466696_259770 | 3300042596 | Bacteria | 3415 |
| 109 | Ga0123355_10002723 | 3300009826 | Bacteria | 25034 |
| 110 | Ga0123353_10198337 | 3300010167 | Bacteria | 3161 |
| 111 | Ga0123354_10207412 | 3300010882 | Bacteria | 2131 |
| 112 | Ga0466706_142153 | 3300042599 | Bacteria | 4178 |
| 113 | Ga0466706_155209 | 3300042599 | Bacteria | 186431 |
| 114 | Ga0466719_084668 | 3300042606 | Bacteria | 20994 |
| 115 | Ga0466719_204858 | 3300042606 | Unclassified | 1173 |
| 116 | JGI24696J40584_12689856 | 3300002834 | Unclassified | 727 |
| 117 | Ga0068305_10011155 | 3300005083 | Unclassified | 18628 |
| 118 | Ga0466705_137314 | 3300042612 | Bacteria | 13682 |
| 119 | Ga0466735_002174 | 3300042624 | Bacteria | 6938 |
| 120 | Ga0466735_078730 | 3300042624 | Bacteria | 29190 |
| 121 | Ga0466735_104691 | 3300042624 | Bacteria | 2327 |
| 122 | Ga0466730_032988 | 3300042625 | Unclassified | 1709 |
| 123 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 124 | Ga0466704_012048 | 3300042643 | Bacteria | 79416 |
| 125 | Ga0466704_441529 | 3300042643 | Bacteria | 68825 |
| 126 | Ga0466708_082069 | 3300042652 | Bacteria | 9055 |
| 127 | Ga0466705_401142 | 3300042612 | Bacteria | 1090 |
| 128 | Ga0466705_507688 | 3300042612 | Bacteria | 3052 |
| 129 | Ga0466729_092400 | 3300042621 | Bacteria | 15201 |
| 130 | Ga0160441_102287 | 3300012825 | Bacteria | 4008 |
| 131 | Ga0466690_409741 | 3300042590 | Bacteria | 18219 |
| 132 | Ga0466696_062709 | 3300042596 | Unclassified | 17794 |
| 133 | Ga0123357_10079115 | 3300009784 | Bacteria | 4330 |
| 134 | Ga0123353_10814944 | 3300010167 | Unclassified | 1286 |
| 135 | Ga0466701_028066 | 3300042598 | Bacteria | 6458 |
| 136 | Ga0466713_018116 | 3300042602 | Bacteria | 13529 |
| 137 | Ga0466716_035184 | 3300042605 | Bacteria | 13442 |
| 138 | Ga0466719_316760 | 3300042606 | Bacteria | 11612 |
| 139 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 140 | JGI24705J35276_12237895 | 3300002504 | Bacteria | 13923 |
| 141 | Ga0068302_10002407 | 3300005071 | Unclassified | 7147 |
| 142 | Ga0068305_10000652 | 3300005083 | Bacteria | 31848 |
| 143 | Ga0104049_1135063 | 3300007103 | Unclassified | 1223 |
| 144 | Ga0466729_246391 | 3300042621 | Bacteria | 2198 |
| 145 | Ga0466735_060411 | 3300042624 | Bacteria | 39440 |
| 146 | Ga0466735_105321 | 3300042624 | Bacteria | 15833 |
| 147 | Ga0466727_337878 | 3300042655 | Bacteria | 1011 |
| 148 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 149 | Ga0466715_098538 | 3300042616 | Bacteria | 131452 |
| 150 | Ga0466728_403783 | 3300042620 | Bacteria | 66570 |
| 151 | Ga0466690_102362 | 3300042590 | Bacteria | 14476 |
| 152 | Ga0466690_226741 | 3300042590 | Bacteria | 23229 |
| 153 | Ga0466690_260994 | 3300042590 | Unclassified | 1184 |
| 154 | Ga0466694_114966 | 3300042594 | Unclassified | 12996 |
| 155 | Ga0123356_10154607 | 3300010049 | Bacteria | 2282 |
| 156 | Ga0123356_10851474 | 3300010049 | Bacteria | 1083 |
| 157 | Ga0123353_10018207 | 3300010167 | Bacteria | 10374 |
| 158 | Ga0466706_176363 | 3300042599 | Bacteria | 2661 |
| 159 | Ga0466700_154695 | 3300042600 | Bacteria | 3922 |
| 160 | Ga0466707_027468 | 3300042601 | Bacteria | 23177 |
| 161 | Ga0466707_027806 | 3300042601 | Bacteria | 8664 |
| 162 | Ga0466713_145751 | 3300042602 | Bacteria | 3648 |
| 163 | Ga0466716_267638 | 3300042605 | Bacteria | 5417 |
| 164 | Ga0466716_453672 | 3300042605 | Unclassified | 6469 |
| 165 | Ga0104044_1147169 | 3300007136 | Unclassified | 1629 |
| 166 | Ga0466704_168259 | 3300042643 | Unclassified | 18757 |
| 167 | Ga0466709_409185 | 3300042648 | Unclassified | 21482 |
| 168 | Ga0466727_172156 | 3300042655 | Bacteria | 156225 |
| 169 | Ga0466727_182221 | 3300042655 | Bacteria | 1459 |
| 170 | Ga0466711_217973 | 3300042615 | Bacteria | 218633 |
| 171 | Ga0466715_520560 | 3300042616 | Bacteria | 11067 |
| 172 | Ga0466723_137137 | 3300042618 | Bacteria | 99723 |
| 173 | Ga0466726_387560 | 3300042619 | Bacteria | 3140 |
| 174 | Ga0466726_387678 | 3300042619 | Bacteria | 397429 |
| 175 | Ga0466728_407609 | 3300042620 | Bacteria | 161023 |
| 176 | Ga0466729_097433 | 3300042621 | Bacteria | 5437 |
| 177 | Ga0466727_352781 | 3300042655 | Bacteria | 7905 |
| 178 | Ga0123357_10195627 | 3300009784 | Unclassified | 2317 |
| 179 | Ga0123357_10196950 | 3300009784 | Unclassified | 2304 |
| 180 | Ga0123355_10145282 | 3300009826 | Bacteria | 3618 |
| 181 | Ga0123356_11000414 | 3300010049 | Bacteria | 1006 |
| 182 | Ga0123353_10824576 | 3300010167 | Bacteria | 1276 |
| 183 | Ga0466706_098285 | 3300042599 | Bacteria | 1978 |
| 184 | Ga0466707_079898 | 3300042601 | Bacteria | 5473 |
| 185 | Ga0466707_096790 | 3300042601 | Bacteria | 31095 |
| 186 | Ga0466717_007940 | 3300042604 | Bacteria | 1215 |
| 187 | Ga0466716_048829 | 3300042605 | Bacteria | 7740 |
| 188 | 2227493099 | 2225789004 | Bacteria | 779 |
| 189 | JGI24702J35022_10072886 | 3300002462 | Unclassified | 1851 |
| 190 | JGI24705J35276_12238656 | 3300002504 | Bacteria | 32645 |
| 191 | Ga0068302_10001906 | 3300005071 | Bacteria | 14965 |
| 192 | Ga0072940_1160775 | 3300005200 | Bacteria | 1532 |
| 193 | Ga0072940_1187764 | 3300005200 | Bacteria | 589 |
| 194 | Ga0466734_028980 | 3300042623 | Bacteria | 12082 |
| 195 | Ga0466704_263415 | 3300042643 | Bacteria | 3952 |
| 196 | Ga0466704_396136 | 3300042643 | Unclassified | 1298 |
| 197 | Ga0466704_426358 | 3300042643 | Bacteria | 3249 |
| 198 | Ga0466704_553916 | 3300042643 | Unclassified | 10413 |
| 199 | Ga0466727_004981 | 3300042655 | Bacteria | 59194 |
| 200 | Ga0466727_257139 | 3300042655 | Bacteria | 56896 |
| 201 | Ga0466711_477748 | 3300042615 | Bacteria | 2311 |
| 202 | Ga0466715_259629 | 3300042616 | Bacteria | 16703 |
| 203 | Ga0466723_209602 | 3300042618 | Bacteria | 3063 |
| 204 | Ga0466726_110200 | 3300042619 | Bacteria | 38777 |
| 205 | Ga0466728_312781 | 3300042620 | Bacteria | 1197 |
| 206 | Ga0466729_076404 | 3300042621 | Bacteria | 53799 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00453 | Ribosomal_L20 | Ribosomal protein L20 | 12 | 118 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.