Protein Family IF06442
Metagenome
Isolate
179
Members
41
Samples
176
Scaffolds
306.5
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_015413|Ga0466719_015413_825_1751
- Length
- 303 aa
- Sequence
- MARVEKITDLIGKTPIVKINKLNDGGATVYVKLEYFNPLHSVKDRIALAMIEAAEKDGRITKDTTIIEPTSGNTGIGLAFIAAVKGYKLILTMPETMSIERRKLLKALGAQLVLTEGAKGMKGAIAKAEELAASTPNSFIPQQFDNPANPKIHEKTTGDTEGKVDILIGGVGTGGTISGAGKFLKSKKPSVQVIAVEPASSPVLSGGSPGPHKIQGIGAGFIPKVFDKAVVDEIYETDDTKAAYAARRAAKEEGLFVGISSGSALEAALTVAKRPENKGKTIVAILPDTGERYLSTWLWDDAS
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.0%
Termitidae
32.5%
Unclassified
12.5%
Rhinotermitidae
10.0%
Termopsidae
7.5%
Hodotermitidae
2.5%
Taxonomy
Archaea
0
Bacteria
164
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 12 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 13 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 14 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_001517 | 3300042591 | Bacteria | 1440 |
| 2 | Ga0466706_151899 | 3300042599 | Bacteria | 4999 |
| 3 | Ga0466707_163217 | 3300042601 | Bacteria | 8991 |
| 4 | Ga0466707_263373 | 3300042601 | Bacteria | 1283 |
| 5 | Ga0466716_196998 | 3300042605 | Bacteria | 4478 |
| 6 | Ga0466722_107857 | 3300042609 | Bacteria | 1869 |
| 7 | Ga0466735_010917 | 3300042624 | Bacteria | 1916 |
| 8 | Ga0466703_037051 | 3300042636 | Bacteria | 10749 |
| 9 | Ga0466703_158527 | 3300042636 | Bacteria | 7401 |
| 10 | Ga0466709_291056 | 3300042648 | Bacteria | 11484 |
| 11 | Ga0466708_298050 | 3300042652 | Unclassified | 1532 |
| 12 | Ga0466727_089824 | 3300042655 | Bacteria | 1696 |
| 13 | Ga0466715_329333 | 3300042616 | Bacteria | 4605 |
| 14 | Ga0466715_404673 | 3300042616 | Unclassified | 2951 |
| 15 | Ga0466726_084190 | 3300042619 | Bacteria | 1480 |
| 16 | Ga0466726_373418 | 3300042619 | Bacteria | 4981 |
| 17 | Ga0466726_476171 | 3300042619 | Bacteria | 1559 |
| 18 | Ga0466728_024517 | 3300042620 | Bacteria | 21124 |
| 19 | Ga0466728_140308 | 3300042620 | Bacteria | 3130 |
| 20 | Ga0466729_116417 | 3300042621 | Bacteria | 1073 |
| 21 | Ga0466729_125155 | 3300042621 | Bacteria | 1490 |
| 22 | Ga0456237_0005672 | 3300041968 | Bacteria | 1976 |
| 23 | Ga0466692_051706 | 3300042591 | Bacteria | 9375 |
| 24 | Ga0466691_035269 | 3300042593 | Bacteria | 1257 |
| 25 | Ga0466691_177068 | 3300042593 | Bacteria | 2041 |
| 26 | Ga0123355_10001569 | 3300009826 | Bacteria | 31898 |
| 27 | Ga0123356_10370491 | 3300010049 | Bacteria | 1562 |
| 28 | Ga0466713_109223 | 3300042602 | Bacteria | 1964 |
| 29 | Ga0466719_015413 | 3300042606 | Bacteria | 14380 |
| 30 | Ga0466719_569583 | 3300042606 | Bacteria | 2470 |
| 31 | Ga0466720_185688 | 3300042607 | Bacteria | 11780 |
| 32 | Ga0466722_138889 | 3300042609 | Bacteria | 1340 |
| 33 | Ga0466722_211020 | 3300042609 | Bacteria | 2009 |
| 34 | Ga0466722_220674 | 3300042609 | Bacteria | 6284 |
| 35 | FAAS_10001470 | 3300001880 | Bacteria | 1391 |
| 36 | Ga0466705_015926 | 3300042612 | Bacteria | 1667 |
| 37 | Ga0466703_122966 | 3300042636 | Bacteria | 6271 |
| 38 | Ga0466703_204295 | 3300042636 | Bacteria | 43577 |
| 39 | Ga0466704_147108 | 3300042643 | Bacteria | 2636 |
| 40 | Ga0466704_285386 | 3300042643 | Bacteria | 59541 |
| 41 | Ga0466708_086449 | 3300042652 | Bacteria | 3893 |
| 42 | Ga0466708_277057 | 3300042652 | Bacteria | 8529 |
| 43 | Ga0466708_310320 | 3300042652 | Bacteria | 19434 |
| 44 | Ga0466705_480956 | 3300042612 | Bacteria | 2861 |
| 45 | Ga0466712_012783 | 3300042614 | Bacteria | 3866 |
| 46 | Ga0466711_142177 | 3300042615 | Bacteria | 6546 |
| 47 | Ga0466715_176108 | 3300042616 | Bacteria | 2826 |
| 48 | Ga0466723_004455 | 3300042618 | Bacteria | 4320 |
| 49 | Ga0466723_041927 | 3300042618 | Bacteria | 12042 |
| 50 | Ga0466690_194453 | 3300042590 | Bacteria | 24666 |
| 51 | Ga0466690_255294 | 3300042590 | Unclassified | 7369 |
| 52 | Ga0466690_342218 | 3300042590 | Bacteria | 6775 |
| 53 | Ga0466692_002816 | 3300042591 | Bacteria | 3179 |
| 54 | Ga0466691_184260 | 3300042593 | Bacteria | 1890 |
| 55 | Ga0466696_080046 | 3300042596 | Bacteria | 3892 |
| 56 | Ga0123356_10124440 | 3300010049 | Bacteria | 2514 |
| 57 | Ga0466719_350731 | 3300042606 | Bacteria | 7749 |
| 58 | Ga0466722_187311 | 3300042609 | Bacteria | 1833 |
| 59 | Ga0466705_269143 | 3300042612 | Bacteria | 16758 |
| 60 | Ga0466703_311035 | 3300042636 | Bacteria | 10783 |
| 61 | Ga0466709_001338 | 3300042648 | Bacteria | 5871 |
| 62 | Ga0466708_007454 | 3300042652 | Bacteria | 7478 |
| 63 | Ga0466708_126852 | 3300042652 | Unclassified | 4691 |
| 64 | Ga0466727_103963 | 3300042655 | Bacteria | 1356 |
| 65 | Ga0466715_050901 | 3300042616 | Bacteria | 6846 |
| 66 | Ga0466715_073807 | 3300042616 | Bacteria | 13111 |
| 67 | Ga0466715_196776 | 3300042616 | Bacteria | 8612 |
| 68 | Ga0466723_022592 | 3300042618 | Unclassified | 2149 |
| 69 | Ga0466728_071073 | 3300042620 | Unclassified | 2430 |
| 70 | Ga0466690_215511 | 3300042590 | Bacteria | 15254 |
| 71 | Ga0466692_094227 | 3300042591 | Bacteria | 1553 |
| 72 | Ga0466692_176615 | 3300042591 | Bacteria | 15638 |
| 73 | Ga0466691_070543 | 3300042593 | Bacteria | 8131 |
| 74 | Ga0466696_349610 | 3300042596 | Bacteria | 15799 |
| 75 | Ga0466713_081415 | 3300042602 | Bacteria | 3243 |
| 76 | Ga0466719_104364 | 3300042606 | Bacteria | 6447 |
| 77 | Ga0466719_428653 | 3300042606 | Bacteria | 24145 |
| 78 | Ga0466722_200433 | 3300042609 | Bacteria | 2289 |
| 79 | AustNasuHG_c1004406 | 3300000089 | Unclassified | 5050 |
| 80 | Ga0466703_316459 | 3300042636 | Bacteria | 1303 |
| 81 | Ga0466709_129741 | 3300042648 | Unclassified | 4331 |
| 82 | Ga0466705_441109 | 3300042612 | Bacteria | 11408 |
| 83 | Ga0466711_350846 | 3300042615 | Bacteria | 8868 |
| 84 | Ga0466715_124778 | 3300042616 | Bacteria | 6679 |
| 85 | Ga0466715_495248 | 3300042616 | Bacteria | 5754 |
| 86 | Ga0466718_115072 | 3300042617 | Bacteria | 2256 |
| 87 | Ga0466723_319236 | 3300042618 | Bacteria | 2459 |
| 88 | Ga0466726_190090 | 3300042619 | Bacteria | 3812 |
| 89 | Ga0466726_320999 | 3300042619 | Bacteria | 21830 |
| 90 | Ga0466728_032748 | 3300042620 | Bacteria | 22105 |
| 91 | Ga0466692_053884 | 3300042591 | Bacteria | 1332 |
| 92 | Ga0466691_067927 | 3300042593 | Bacteria | 8108 |
| 93 | Ga0466694_324338 | 3300042594 | Bacteria | 2602 |
| 94 | Ga0466707_073344 | 3300042601 | Bacteria | 10549 |
| 95 | Ga0466707_080480 | 3300042601 | Unclassified | 1295 |
| 96 | Ga0466719_424391 | 3300042606 | Bacteria | 2953 |
| 97 | Ga0466719_430518 | 3300042606 | Unclassified | 1179 |
| 98 | Ga0466719_498100 | 3300042606 | Bacteria | 1765 |
| 99 | Ga0466698_434685 | 3300042610 | Bacteria | 3582 |
| 100 | JGI24695J34938_10073105 | 3300002450 | Bacteria | 1429 |
| 101 | Ga0466703_098539 | 3300042636 | Bacteria | 5658 |
| 102 | Ga0466703_177672 | 3300042636 | Bacteria | 1349 |
| 103 | Ga0466704_163745 | 3300042643 | Bacteria | 4013 |
| 104 | Ga0466709_387105 | 3300042648 | Bacteria | 2288 |
| 105 | Ga0466708_274857 | 3300042652 | Bacteria | 29137 |
| 106 | Ga0466715_227941 | 3300042616 | Bacteria | 4836 |
| 107 | Ga0466723_035229 | 3300042618 | Bacteria | 16906 |
| 108 | Ga0466723_042900 | 3300042618 | Bacteria | 3420 |
| 109 | Ga0466726_412546 | 3300042619 | Bacteria | 1556 |
| 110 | Ga0456237_0007301 | 3300041968 | Bacteria | 1704 |
| 111 | Ga0466690_097767 | 3300042590 | Bacteria | 7757 |
| 112 | Ga0123354_10092849 | 3300010882 | Bacteria | 4153 |
| 113 | Ga0466700_342590 | 3300042600 | Bacteria | 1106 |
| 114 | Ga0466707_234504 | 3300042601 | Unclassified | 1026 |
| 115 | Ga0466716_088475 | 3300042605 | Bacteria | 4992 |
| 116 | JGI24698J34947_10000024 | 3300002449 | Bacteria | 40348 |
| 117 | JGI24698J34947_10008828 | 3300002449 | Bacteria | 5530 |
| 118 | Ga0466704_439686 | 3300042643 | Bacteria | 95559 |
| 119 | Ga0466709_019100 | 3300042648 | Bacteria | 11750 |
| 120 | Ga0466709_315520 | 3300042648 | Bacteria | 2190 |
| 121 | Ga0466708_099906 | 3300042652 | Bacteria | 39915 |
| 122 | Ga0466705_500345 | 3300042612 | Bacteria | 7491 |
| 123 | Ga0466711_253961 | 3300042615 | Bacteria | 28887 |
| 124 | Ga0466711_410799 | 3300042615 | Bacteria | 6127 |
| 125 | Ga0466715_328283 | 3300042616 | Bacteria | 2020 |
| 126 | Ga0466718_052897 | 3300042617 | Bacteria | 8235 |
| 127 | Ga0466723_050191 | 3300042618 | Unclassified | 2989 |
| 128 | Ga0466728_172039 | 3300042620 | Bacteria | 5508 |
| 129 | Ga0466690_101941 | 3300042590 | Bacteria | 8963 |
| 130 | Ga0466690_222136 | 3300042590 | Bacteria | 2704 |
| 131 | Ga0466692_048692 | 3300042591 | Bacteria | 4608 |
| 132 | Ga0466694_058129 | 3300042594 | Bacteria | 3289 |
| 133 | Ga0466696_193818 | 3300042596 | Bacteria | 2960 |
| 134 | Ga0466696_404776 | 3300042596 | Bacteria | 12764 |
| 135 | Ga0123356_10020001 | 3300010049 | Bacteria | 6340 |
| 136 | Ga0466707_312057 | 3300042601 | Bacteria | 1346 |
| 137 | Ga0466716_108913 | 3300042605 | Bacteria | 11846 |
| 138 | Ga0466716_274199 | 3300042605 | Bacteria | 1348 |
| 139 | Ga0466719_077112 | 3300042606 | Bacteria | 68925 |
| 140 | Ga0466722_040920 | 3300042609 | Bacteria | 2709 |
| 141 | JGI24698J34947_10010863 | 3300002449 | Bacteria | 4996 |
| 142 | JGI24695J34938_10005396 | 3300002450 | Bacteria | 7981 |
| 143 | Ga0466729_200313 | 3300042621 | Unclassified | 1123 |
| 144 | Ga0466704_533185 | 3300042643 | Bacteria | 78418 |
| 145 | Ga0466711_122412 | 3300042615 | Bacteria | 3921 |
| 146 | Ga0466711_227800 | 3300042615 | Bacteria | 12931 |
| 147 | Ga0466715_093542 | 3300042616 | Bacteria | 9079 |
| 148 | Ga0466715_588131 | 3300042616 | Bacteria | 26458 |
| 149 | Ga0466723_020602 | 3300042618 | Bacteria | 4183 |
| 150 | Ga0466726_073757 | 3300042619 | Bacteria | 1593 |
| 151 | Ga0466726_142892 | 3300042619 | Bacteria | 1779 |
| 152 | Ga0466726_212831 | 3300042619 | Bacteria | 1084 |
| 153 | Ga0466690_130357 | 3300042590 | Bacteria | 2286 |
| 154 | Ga0466691_025561 | 3300042593 | Bacteria | 1283 |
| 155 | Ga0466694_106389 | 3300042594 | Bacteria | 1853 |
| 156 | Ga0123356_10108008 | 3300010049 | Bacteria | 2682 |
| 157 | Ga0123356_10596647 | 3300010049 | Bacteria | 1269 |
| 158 | Ga0123353_10047786 | 3300010167 | Bacteria | 6809 |
| 159 | Ga0466700_162342 | 3300042600 | Bacteria | 3104 |
| 160 | Ga0466719_395167 | 3300042606 | Bacteria | 1764 |
| 161 | Ga0466722_192535 | 3300042609 | Bacteria | 1411 |
| 162 | JGI24698J34947_10117181 | 3300002449 | Unclassified | 1163 |
| 163 | Ga0466705_287161 | 3300042612 | Bacteria | 2599 |
| 164 | Ga0466704_208436 | 3300042643 | Bacteria | 6504 |
| 165 | Ga0466704_434098 | 3300042643 | Bacteria | 82573 |
| 166 | Ga0466708_103476 | 3300042652 | Bacteria | 3584 |
| 167 | Ga0466727_004655 | 3300042655 | Bacteria | 1950 |
| 168 | Ga0466727_030956 | 3300042655 | Bacteria | 11790 |
| 169 | Ga0466727_258877 | 3300042655 | Bacteria | 1320 |
| 170 | Ga0466711_046942 | 3300042615 | Bacteria | 3347 |
| 171 | Ga0466711_211388 | 3300042615 | Bacteria | 3744 |
| 172 | Ga0466715_308389 | 3300042616 | Bacteria | 3518 |
| 173 | Ga0466715_482398 | 3300042616 | Bacteria | 4888 |
| 174 | Ga0466723_135180 | 3300042618 | Bacteria | 7369 |
| 175 | Ga0466723_248039 | 3300042618 | Bacteria | 1989 |
| 176 | Ga0466726_064957 | 3300042619 | Unclassified | 3018 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00291 | PALP | Pyridoxal-phosphate dependent enzyme | 7 | 288 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.