Protein Family IF06425
Metagenome
Isolate
218
Members
64
Samples
204
Scaffolds
260.21
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_467205|Ga0466716_467205_2193_3002
- Length
- 269 aa
- Sequence
- MVRSLWTGASGMIGQQANIDTISNNLANVNTAGYKKMRADFEDLLYQTVKTAGTPATEETVVPVGIQMGHGVKLADTQRMFSQGAPQSTENVTDMAIVGDGFFRIQMYDGSWAYTRNGAFEVDSDGRMVTSNGYWLLPDIIMPERFLPQTINVTQDGRVSVKVPGYDDNADPVEVEVGQLELYRFPNPVGLTAVGENLFKITEASGDPIPGRPGYNGMGKLYHKFLEMSNVSVVREMVDLIVAQRAYEFNSRTIQTSDNMLGTATSLKR
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.3%
Unclassified
24.2%
Kalotermitidae
22.6%
Rhinotermitidae
6.5%
Termopsidae
4.8%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
194
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 13 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 16 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 19 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 35 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 36 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 39 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 40 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 45 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 46 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 49 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 53 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 54 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 55 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 56 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 57 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 59 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 60 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 61 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 62 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 63 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 64 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_168444 | 3300042612 | Bacteria | 7470 |
| 2 | JGI24698J34947_10000118 | 3300002449 | Bacteria | 27962 |
| 3 | JGI24695J34938_10044855 | 3300002450 | Bacteria | 1964 |
| 4 | Ga0072941_1052916 | 3300005201 | Bacteria | 4887 |
| 5 | Ga0074263_101544 | 3300005485 | Bacteria | 2429 |
| 6 | Ga0123356_10000125 | 3300010049 | Bacteria | 84722 |
| 7 | Ga0466712_314745 | 3300042614 | Bacteria | 34934 |
| 8 | Ga0466715_245983 | 3300042616 | Bacteria | 27497 |
| 9 | Ga0466723_044039 | 3300042618 | Unclassified | 2108 |
| 10 | Ga0466723_306720 | 3300042618 | Bacteria | 4694 |
| 11 | Ga0466726_035156 | 3300042619 | Bacteria | 3053 |
| 12 | Ga0466728_177222 | 3300042620 | Bacteria | 5778 |
| 13 | Ga0456237_0012410 | 3300041968 | Bacteria | 1232 |
| 14 | Ga0466690_048923 | 3300042590 | Bacteria | 2868 |
| 15 | Ga0466692_035007 | 3300042591 | Unclassified | 1926 |
| 16 | Ga0466696_060680 | 3300042596 | Unclassified | 12096 |
| 17 | Ga0466696_396177 | 3300042596 | Bacteria | 1914 |
| 18 | Ga0466699_130586 | 3300042597 | Bacteria | 14073 |
| 19 | Ga0466699_294364 | 3300042597 | Bacteria | 4888 |
| 20 | Ga0466717_129730 | 3300042604 | Bacteria | 1429 |
| 21 | Ga0466722_035175 | 3300042609 | Bacteria | 7319 |
| 22 | Ga0466735_126162 | 3300042624 | Bacteria | 1498 |
| 23 | Ga0466703_142193 | 3300042636 | Bacteria | 17251 |
| 24 | Ga0466708_041724 | 3300042652 | Bacteria | 12518 |
| 25 | Ga0466708_080449 | 3300042652 | Bacteria | 24208 |
| 26 | JGI24698J34947_10089132 | 3300002449 | Bacteria | 1421 |
| 27 | JGI24695J34938_10003553 | 3300002450 | Bacteria | 10769 |
| 28 | JGI24695J34938_10030264 | 3300002450 | Bacteria | 2522 |
| 29 | JGI24702J35022_10091363 | 3300002462 | Bacteria | 1657 |
| 30 | JGI24700J35501_10929598 | 3300002508 | Bacteria | 9619 |
| 31 | Ga0072941_1007326 | 3300005201 | Bacteria | 8157 |
| 32 | Ga0072941_1073115 | 3300005201 | Bacteria | 1437 |
| 33 | Ga0123356_10152737 | 3300010049 | Bacteria | 2295 |
| 34 | Ga0123356_11051158 | 3300010049 | Bacteria | 984 |
| 35 | Ga0466705_460419 | 3300042612 | Bacteria | 1451 |
| 36 | Ga0466712_035782 | 3300042614 | Bacteria | 14619 |
| 37 | Ga0466712_036297 | 3300042614 | Bacteria | 11718 |
| 38 | Ga0466712_048722 | 3300042614 | Bacteria | 18693 |
| 39 | Ga0466712_120010 | 3300042614 | Bacteria | 41166 |
| 40 | Ga0466711_011022 | 3300042615 | Bacteria | 14478 |
| 41 | Ga0466718_158603 | 3300042617 | Bacteria | 6249 |
| 42 | Ga0466723_202458 | 3300042618 | Bacteria | 23450 |
| 43 | Ga0264413_104241 | 3300024493 | Bacteria | 12765 |
| 44 | Ga0466690_067522 | 3300042590 | Bacteria | 7773 |
| 45 | Ga0466692_037966 | 3300042591 | Bacteria | 12197 |
| 46 | Ga0466691_075246 | 3300042593 | Bacteria | 9950 |
| 47 | Ga0466691_225704 | 3300042593 | Bacteria | 32229 |
| 48 | Ga0466695_131626 | 3300042595 | Bacteria | 1296 |
| 49 | Ga0466696_090044 | 3300042596 | Bacteria | 19399 |
| 50 | Ga0466706_163930 | 3300042599 | Bacteria | 3902 |
| 51 | Ga0466706_173920 | 3300042599 | Bacteria | 2413 |
| 52 | Ga0466731_029461 | 3300042622 | Bacteria | 1877 |
| 53 | Ga0466703_109925 | 3300042636 | Bacteria | 32972 |
| 54 | Ga0466704_527222 | 3300042643 | Bacteria | 45743 |
| 55 | Ga0466709_001356 | 3300042648 | Bacteria | 34748 |
| 56 | Ga0466709_107840 | 3300042648 | Bacteria | 35808 |
| 57 | JGI24698J34947_10005427 | 3300002449 | Bacteria | 6995 |
| 58 | JGI24698J34947_10022433 | 3300002449 | Bacteria | 3386 |
| 59 | JGI24698J34947_10029693 | 3300002449 | Bacteria | 2887 |
| 60 | JGI24698J34947_10085316 | 3300002449 | Bacteria | 1467 |
| 61 | JGI24695J34938_10009610 | 3300002450 | Unclassified | 5364 |
| 62 | JGI24695J34938_10048394 | 3300002450 | Bacteria | 1872 |
| 63 | JGI24702J35022_10046571 | 3300002462 | Unclassified | 2309 |
| 64 | Ga0072941_1084232 | 3300005201 | Bacteria | 4388 |
| 65 | Ga0123356_10264851 | 3300010049 | Bacteria | 1805 |
| 66 | Ga0123353_10077005 | 3300010167 | Bacteria | 5360 |
| 67 | Ga0123353_10159088 | 3300010167 | Bacteria | 3598 |
| 68 | Ga0123353_10697290 | 3300010167 | Bacteria | 1426 |
| 69 | Ga0123353_10772029 | 3300010167 | Bacteria | 1333 |
| 70 | Ga0466712_280947 | 3300042614 | Bacteria | 24396 |
| 71 | Ga0466711_154232 | 3300042615 | Bacteria | 21041 |
| 72 | Ga0466718_071872 | 3300042617 | Unclassified | 1646 |
| 73 | Ga0466726_102895 | 3300042619 | Bacteria | 7647 |
| 74 | Ga0466726_247710 | 3300042619 | Bacteria | 3098 |
| 75 | Ga0466726_381832 | 3300042619 | Unclassified | 4884 |
| 76 | Ga0466690_307023 | 3300042590 | Bacteria | 2472 |
| 77 | Ga0466692_034388 | 3300042591 | Bacteria | 1317 |
| 78 | Ga0466692_180890 | 3300042591 | Bacteria | 1455 |
| 79 | Ga0466696_034640 | 3300042596 | Bacteria | 3932 |
| 80 | Ga0466699_116673 | 3300042597 | Bacteria | 22899 |
| 81 | Ga0466719_016801 | 3300042606 | Bacteria | 34227 |
| 82 | Ga0466719_026467 | 3300042606 | Bacteria | 1795 |
| 83 | Ga0466720_057804 | 3300042607 | Bacteria | 49318 |
| 84 | Ga0466720_139654 | 3300042607 | Unclassified | 1857 |
| 85 | Ga0466721_141227 | 3300042608 | Bacteria | 1832 |
| 86 | Ga0466722_025196 | 3300042609 | Bacteria | 2306 |
| 87 | Ga0466729_198364 | 3300042621 | Bacteria | 2154 |
| 88 | Ga0466735_007176 | 3300042624 | Bacteria | 7706 |
| 89 | Ga0466704_216804 | 3300042643 | Bacteria | 12927 |
| 90 | JGI24698J34947_10001209 | 3300002449 | Bacteria | 13513 |
| 91 | JGI24702J35022_10009521 | 3300002462 | Bacteria | 5447 |
| 92 | Ga0072941_1025242 | 3300005201 | Bacteria | 31965 |
| 93 | Ga0074263_109209 | 3300005485 | Unclassified | 2875 |
| 94 | Ga0466712_127549 | 3300042614 | Bacteria | 15513 |
| 95 | Ga0466718_008845 | 3300042617 | Bacteria | 21310 |
| 96 | Ga0466723_294471 | 3300042618 | Bacteria | 31115 |
| 97 | Ga0466729_122995 | 3300042621 | Bacteria | 1040 |
| 98 | Ga0415639_118084 | 3300038395 | Bacteria | 5486 |
| 99 | Ga0466690_146011 | 3300042590 | Bacteria | 3455 |
| 100 | Ga0466691_140938 | 3300042593 | Bacteria | 30510 |
| 101 | Ga0466694_305347 | 3300042594 | Unclassified | 2452 |
| 102 | Ga0466695_044084 | 3300042595 | Bacteria | 32843 |
| 103 | Ga0466695_054925 | 3300042595 | Bacteria | 6471 |
| 104 | Ga0466699_239715 | 3300042597 | Bacteria | 12439 |
| 105 | Ga0466707_012671 | 3300042601 | Bacteria | 1019 |
| 106 | Ga0466716_458036 | 3300042605 | Bacteria | 4033 |
| 107 | Ga0466719_225450 | 3300042606 | Bacteria | 68670 |
| 108 | Ga0466722_189351 | 3300042609 | Bacteria | 2610 |
| 109 | Ga0466722_193003 | 3300042609 | Bacteria | 4666 |
| 110 | Ga0466702_413884 | 3300042635 | Bacteria | 1103 |
| 111 | Ga0466703_235923 | 3300042636 | Bacteria | 15696 |
| 112 | Ga0466704_409085 | 3300042643 | Bacteria | 13117 |
| 113 | Ga0466708_056704 | 3300042652 | Unclassified | 2133 |
| 114 | JGI24698J34947_10074333 | 3300002449 | Unclassified | 1619 |
| 115 | JGI24698J34947_10169253 | 3300002449 | Bacteria | 886 |
| 116 | Ga0072941_1006421 | 3300005201 | Bacteria | 15601 |
| 117 | Ga0123354_10083975 | 3300010882 | Bacteria | 4476 |
| 118 | Ga0466712_143410 | 3300042614 | Bacteria | 1020 |
| 119 | Ga0466718_092081 | 3300042617 | Bacteria | 3978 |
| 120 | Ga0466723_059819 | 3300042618 | Bacteria | 8638 |
| 121 | Ga0466726_289375 | 3300042619 | Bacteria | 2867 |
| 122 | Ga0466728_352553 | 3300042620 | Bacteria | 2041 |
| 123 | Ga0456237_0000454 | 3300041968 | Bacteria | 6189 |
| 124 | Ga0466690_023298 | 3300042590 | Bacteria | 45810 |
| 125 | Ga0466690_345283 | 3300042590 | Bacteria | 15147 |
| 126 | Ga0466691_044027 | 3300042593 | Bacteria | 37731 |
| 127 | Ga0466694_030859 | 3300042594 | Bacteria | 7597 |
| 128 | Ga0466694_119471 | 3300042594 | Bacteria | 3739 |
| 129 | Ga0466716_317184 | 3300042605 | Bacteria | 4285 |
| 130 | Ga0466716_467205 | 3300042605 | Bacteria | 3961 |
| 131 | Ga0466722_020411 | 3300042609 | Bacteria | 1442 |
| 132 | Ga0466704_269527 | 3300042643 | Bacteria | 9014 |
| 133 | Ga0466708_211379 | 3300042652 | Unclassified | 2527 |
| 134 | Ga0466727_019165 | 3300042655 | Bacteria | 1680 |
| 135 | JGI24698J34947_10003161 | 3300002449 | Bacteria | 8910 |
| 136 | JGI24695J34938_10038962 | 3300002450 | Bacteria | 2150 |
| 137 | JGI24695J34938_10046270 | 3300002450 | Bacteria | 1926 |
| 138 | JGI24702J35022_10158872 | 3300002462 | Bacteria | 1272 |
| 139 | Ga0123357_10042260 | 3300009784 | Bacteria | 6199 |
| 140 | Ga0123357_10093663 | 3300009784 | Bacteria | 3903 |
| 141 | Ga0123357_10318829 | 3300009784 | Unclassified | 1539 |
| 142 | Ga0123357_10482880 | 3300009784 | Bacteria | 1045 |
| 143 | Ga0466712_005525 | 3300042614 | Bacteria | 2224 |
| 144 | Ga0466712_081917 | 3300042614 | Bacteria | 63418 |
| 145 | Ga0466711_395245 | 3300042615 | Bacteria | 23330 |
| 146 | Ga0466718_025962 | 3300042617 | Bacteria | 9511 |
| 147 | Ga0466718_080360 | 3300042617 | Bacteria | 1105 |
| 148 | Ga0466718_101616 | 3300042617 | Bacteria | 9581 |
| 149 | Ga0466718_128479 | 3300042617 | Bacteria | 1043 |
| 150 | Ga0466723_053524 | 3300042618 | Bacteria | 25546 |
| 151 | Ga0415639_088649 | 3300038395 | Bacteria | 5095 |
| 152 | Ga0466694_259900 | 3300042594 | Unclassified | 2486 |
| 153 | Ga0466716_383613 | 3300042605 | Unclassified | 2363 |
| 154 | Ga0466719_542838 | 3300042606 | Unclassified | 1609 |
| 155 | Ga0466720_176035 | 3300042607 | Bacteria | 8542 |
| 156 | Ga0466722_043133 | 3300042609 | Unclassified | 3950 |
| 157 | Ga0466731_280986 | 3300042622 | Bacteria | 1104 |
| 158 | Ga0466708_163511 | 3300042652 | Bacteria | 27131 |
| 159 | Ga0466708_283262 | 3300042652 | Unclassified | 1261 |
| 160 | Ga0466727_325566 | 3300042655 | Bacteria | 19588 |
| 161 | Ga0466705_085627 | 3300042612 | Bacteria | 6848 |
| 162 | Ga0466705_223908 | 3300042612 | Bacteria | 37061 |
| 163 | JGI24698J34947_10081114 | 3300002449 | Bacteria | 1522 |
| 164 | JGI24698J34947_10123977 | 3300002449 | Bacteria | 1116 |
| 165 | JGI24705J35276_12154422 | 3300002504 | Bacteria | 1199 |
| 166 | JGI24697J35500_11260620 | 3300002507 | Bacteria | 2994 |
| 167 | Ga0123353_10038950 | 3300010167 | Bacteria | 7477 |
| 168 | Ga0466712_033445 | 3300042614 | Bacteria | 15060 |
| 169 | Ga0264413_138941 | 3300024493 | Bacteria | 11170 |
| 170 | Ga0415639_002352 | 3300038395 | Bacteria | 10464 |
| 171 | Ga0466693_384897 | 3300042592 | Bacteria | 2610 |
| 172 | Ga0466693_440924 | 3300042592 | Bacteria | 3218 |
| 173 | Ga0466691_036918 | 3300042593 | Unclassified | 4927 |
| 174 | Ga0466694_083770 | 3300042594 | Bacteria | 1140 |
| 175 | Ga0466694_132380 | 3300042594 | Unclassified | 5719 |
| 176 | Ga0466699_098822 | 3300042597 | Bacteria | 1027 |
| 177 | Ga0466699_312502 | 3300042597 | Bacteria | 2561 |
| 178 | Ga0466707_399974 | 3300042601 | Bacteria | 2315 |
| 179 | Ga0466720_062748 | 3300042607 | Unclassified | 1101 |
| 180 | Ga0466722_112951 | 3300042609 | Bacteria | 10781 |
| 181 | Ga0466722_126616 | 3300042609 | Bacteria | 13872 |
| 182 | Ga0466698_016596 | 3300042610 | Bacteria | 3481 |
| 183 | Ga0466735_200216 | 3300042624 | Bacteria | 2948 |
| 184 | Ga0466733_207571 | 3300042659 | Bacteria | 1145 |
| 185 | JGI24698J34947_10006834 | 3300002449 | Bacteria | 6268 |
| 186 | JGI24702J35022_10005087 | 3300002462 | Bacteria | 7730 |
| 187 | Ga0072941_1007325 | 3300005201 | Bacteria | 14092 |
| 188 | Ga0072941_1089485 | 3300005201 | Bacteria | 8046 |
| 189 | Ga0123356_10078354 | 3300010049 | Bacteria | 3119 |
| 190 | Ga0123353_10658220 | 3300010167 | Bacteria | 1481 |
| 191 | Ga0466712_236605 | 3300042614 | Bacteria | 2653 |
| 192 | Ga0466712_314399 | 3300042614 | Bacteria | 2793 |
| 193 | Ga0466718_015511 | 3300042617 | Bacteria | 2418 |
| 194 | Ga0466726_467715 | 3300042619 | Bacteria | 1331 |
| 195 | Ga0466691_040275 | 3300042593 | Unclassified | 1017 |
| 196 | Ga0466691_108580 | 3300042593 | Bacteria | 45868 |
| 197 | Ga0466699_116497 | 3300042597 | Bacteria | 8549 |
| 198 | Ga0466716_144994 | 3300042605 | Bacteria | 1618 |
| 199 | Ga0466716_301856 | 3300042605 | Bacteria | 8479 |
| 200 | Ga0466719_017968 | 3300042606 | Bacteria | 23625 |
| 201 | Ga0466720_233309 | 3300042607 | Bacteria | 6562 |
| 202 | Ga0466722_093351 | 3300042609 | Bacteria | 3253 |
| 203 | Ga0466722_252136 | 3300042609 | Bacteria | 1375 |
| 204 | Ga0466731_414364 | 3300042622 | Unclassified | 1334 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.