Protein Family IF06405
Metagenome
Isolate
255
Members
74
Samples
233
Scaffolds
227.64
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_384664|Ga0466716_384664_1275_2078
- Length
- 267 aa
- Sequence
- MRSLATFCIFGASNGKQKRNPDKLNELYIVIHLKEIHKTYHNGAPLHVLKGIDLEINRGEFVSIMGSSGSGKSTLLNILGILDNYDTGEYYLNNVLIRNLSETKAAEYRNRMIGFIFQSFNLISFKNAMENVALPLFYQGVTRKKRNKLALEYLDRLGLKEWAHHLPNEMSGGQKQRVAIARALITQPQIILADEPTGALDSKTSREVMDILKQLHASGMTIAVVTHESGVANQTNKIIRISDGIIEKVEENDNHEASVFGRDGLIK
Sample Types
Isolate
8.6%
Metagenome
91.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.9%
Blattidae
21.9%
Kalotermitidae
19.2%
Unclassified
11.0%
Rhinotermitidae
5.5%
Termopsidae
5.5%
Passalidae
2.7%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
249
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 20 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 31 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 32 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 33 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 34 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 35 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 47 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 48 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 49 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 50 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 51 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 53 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 54 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 55 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 56 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 57 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 58 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 59 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 60 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 61 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 65 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 66 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 67 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 68 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 69 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 70 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_234689 | 3300042611 | Bacteria | 2228 |
| 2 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 3 | Ga0466718_066798 | 3300042617 | Bacteria | 1747 |
| 4 | Ga0466723_062543 | 3300042618 | Bacteria | 7962 |
| 5 | Ga0466726_027894 | 3300042619 | Bacteria | 10594 |
| 6 | Ga0466726_307255 | 3300042619 | Bacteria | 1455 |
| 7 | Ga0466728_070909 | 3300042620 | Bacteria | 19692 |
| 8 | Ga0466728_338179 | 3300042620 | Bacteria | 2549 |
| 9 | Ga0466729_196103 | 3300042621 | Bacteria | 13470 |
| 10 | Ga0466707_137606 | 3300042601 | Bacteria | 20225 |
| 11 | Ga0466713_061207 | 3300042602 | Bacteria | 22897 |
| 12 | Ga0466716_128873 | 3300042605 | Bacteria | 20808 |
| 13 | Ga0466716_384664 | 3300042605 | Bacteria | 3229 |
| 14 | Ga0466719_168326 | 3300042606 | Bacteria | 3714 |
| 15 | Ga0466719_208743 | 3300042606 | Bacteria | 9101 |
| 16 | Ga0466719_217200 | 3300042606 | Bacteria | 12103 |
| 17 | Ga0466719_569842 | 3300042606 | Bacteria | 6880 |
| 18 | Ga0466722_118699 | 3300042609 | Bacteria | 16514 |
| 19 | Ga0466698_174479 | 3300042610 | Bacteria | 3103 |
| 20 | 2227216895 | 2225789004 | Bacteria | 7548 |
| 21 | IMNBL1DRAFT_c0005800 | 3300000062 | Bacteria | 6936 |
| 22 | JGI24702J35022_10003603 | 3300002462 | Bacteria | 9323 |
| 23 | JGI24702J35022_10082061 | 3300002462 | Bacteria | 1747 |
| 24 | JGI24696J40584_12952790 | 3300002834 | Bacteria | 2394 |
| 25 | Ga0264413_157866 | 3300024493 | Bacteria | 2361 |
| 26 | Ga0466696_125739 | 3300042596 | Bacteria | 14442 |
| 27 | Ga0466699_053161 | 3300042597 | Bacteria | 2300 |
| 28 | Ga0466735_095944 | 3300042624 | Bacteria | 3010 |
| 29 | Ga0466735_125231 | 3300042624 | Bacteria | 6413 |
| 30 | Ga0466703_075023 | 3300042636 | Bacteria | 6321 |
| 31 | Ga0466704_040778 | 3300042643 | Bacteria | 10718 |
| 32 | Ga0466709_172177 | 3300042648 | Bacteria | 27518 |
| 33 | Ga0466708_114192 | 3300042652 | Bacteria | 2806 |
| 34 | Ga0466727_134154 | 3300042655 | Unclassified | 7256 |
| 35 | Ga0466705_076055 | 3300042612 | Bacteria | 2571 |
| 36 | Ga0466715_109794 | 3300042616 | Bacteria | 37807 |
| 37 | Ga0466715_413814 | 3300042616 | Bacteria | 9845 |
| 38 | Ga0466723_046709 | 3300042618 | Bacteria | 21444 |
| 39 | Ga0466723_178178 | 3300042618 | Bacteria | 2083 |
| 40 | Ga0123357_10060591 | 3300009784 | Bacteria | 5076 |
| 41 | Ga0466706_161278 | 3300042599 | Bacteria | 1001 |
| 42 | Ga0466707_050040 | 3300042601 | Bacteria | 9998 |
| 43 | Ga0466713_009199 | 3300042602 | Bacteria | 8653 |
| 44 | Ga0466713_033996 | 3300042602 | Bacteria | 7382 |
| 45 | Ga0466713_122827 | 3300042602 | Bacteria | 174567 |
| 46 | Ga0466714_146645 | 3300042603 | Bacteria | 1477 |
| 47 | Ga0466716_015706 | 3300042605 | Bacteria | 4383 |
| 48 | Ga0466719_084340 | 3300042606 | Bacteria | 14417 |
| 49 | Ga0466722_041850 | 3300042609 | Bacteria | 17417 |
| 50 | Ga0466698_073298 | 3300042610 | Bacteria | 1155 |
| 51 | JGI24705J35276_12237977 | 3300002504 | Bacteria | 14660 |
| 52 | Ga0466690_134124 | 3300042590 | Bacteria | 14927 |
| 53 | Ga0466690_153504 | 3300042590 | Bacteria | 5332 |
| 54 | Ga0466690_370216 | 3300042590 | Bacteria | 1807 |
| 55 | Ga0466690_402600 | 3300042590 | Bacteria | 16777 |
| 56 | Ga0466692_112753 | 3300042591 | Bacteria | 1837 |
| 57 | Ga0466691_112917 | 3300042593 | Bacteria | 16704 |
| 58 | Ga0466696_489056 | 3300042596 | Bacteria | 3534 |
| 59 | Ga0466703_410300 | 3300042636 | Bacteria | 4122 |
| 60 | Ga0466709_164264 | 3300042648 | Bacteria | 10161 |
| 61 | Ga0466709_299038 | 3300042648 | Bacteria | 23402 |
| 62 | Ga0466708_080201 | 3300042652 | Bacteria | 6723 |
| 63 | Ga0466708_098063 | 3300042652 | Bacteria | 8204 |
| 64 | Ga0466711_329754 | 3300042615 | Bacteria | 36740 |
| 65 | Ga0466711_463948 | 3300042615 | Bacteria | 1343 |
| 66 | Ga0466715_024418 | 3300042616 | Bacteria | 13353 |
| 67 | Ga0466715_198201 | 3300042616 | Bacteria | 5069 |
| 68 | Ga0466723_159990 | 3300042618 | Bacteria | 8680 |
| 69 | Ga0466726_306144 | 3300042619 | Bacteria | 2876 |
| 70 | Ga0123354_10021016 | 3300010882 | Bacteria | 10277 |
| 71 | Ga0123354_10409631 | 3300010882 | Bacteria | 1138 |
| 72 | Ga0466701_047043 | 3300042598 | Bacteria | 1540 |
| 73 | Ga0466700_159036 | 3300042600 | Bacteria | 10259 |
| 74 | Ga0466700_387454 | 3300042600 | Bacteria | 47059 |
| 75 | Ga0466707_170677 | 3300042601 | Bacteria | 9263 |
| 76 | Ga0466707_364898 | 3300042601 | Bacteria | 15376 |
| 77 | Ga0466713_029825 | 3300042602 | Bacteria | 9932 |
| 78 | Ga0466716_092661 | 3300042605 | Bacteria | 34549 |
| 79 | JGI24702J35022_10010821 | 3300002462 | Bacteria | 5090 |
| 80 | Ga0068305_10028588 | 3300005083 | Bacteria | 5616 |
| 81 | Ga0466693_054653 | 3300042592 | Bacteria | 1545 |
| 82 | Ga0466696_258276 | 3300042596 | Bacteria | 1663 |
| 83 | Ga0466696_266958 | 3300042596 | Bacteria | 3327 |
| 84 | Ga0466735_037511 | 3300042624 | Bacteria | 2245 |
| 85 | Ga0466735_038539 | 3300042624 | Bacteria | 5271 |
| 86 | Ga0466704_037080 | 3300042643 | Unclassified | 3923 |
| 87 | Ga0466704_075989 | 3300042643 | Bacteria | 13493 |
| 88 | Ga0466704_248039 | 3300042643 | Bacteria | 14735 |
| 89 | Ga0466727_070991 | 3300042655 | Bacteria | 4361 |
| 90 | Ga0466727_229953 | 3300042655 | Bacteria | 7765 |
| 91 | Ga0466705_169455 | 3300042612 | Bacteria | 6120 |
| 92 | Ga0466705_350726 | 3300042612 | Bacteria | 9254 |
| 93 | Ga0466732_300864 | 3300042656 | Bacteria | 2733 |
| 94 | Ga0466711_068474 | 3300042615 | Bacteria | 35660 |
| 95 | Ga0466715_065271 | 3300042616 | Bacteria | 4958 |
| 96 | Ga0466715_103901 | 3300042616 | Bacteria | 35101 |
| 97 | Ga0466723_010238 | 3300042618 | Bacteria | 11206 |
| 98 | Ga0466723_132656 | 3300042618 | Bacteria | 6707 |
| 99 | Ga0466726_035438 | 3300042619 | Bacteria | 13069 |
| 100 | Ga0466728_034392 | 3300042620 | Bacteria | 3371 |
| 101 | Ga0466728_123828 | 3300042620 | Bacteria | 8291 |
| 102 | Ga0123356_10414932 | 3300010049 | Bacteria | 1487 |
| 103 | Ga0123354_10007896 | 3300010882 | Bacteria | 16123 |
| 104 | Ga0123354_10310563 | 3300010882 | Bacteria | 1473 |
| 105 | Ga0466706_042414 | 3300042599 | Bacteria | 11971 |
| 106 | Ga0466707_397960 | 3300042601 | Bacteria | 42331 |
| 107 | Ga0466714_118717 | 3300042603 | Bacteria | 2933 |
| 108 | Ga0466716_162219 | 3300042605 | Bacteria | 7439 |
| 109 | 2227580187 | 2225789004 | Bacteria | 13401 |
| 110 | IMNBL1DRAFT_c0001417 | 3300000062 | Bacteria | 17936 |
| 111 | IMNBL1DRAFT_c0001430 | 3300000062 | Bacteria | 17865 |
| 112 | IMNBL1DRAFT_c0001572 | 3300000062 | Bacteria | 16985 |
| 113 | IMNBL1DRAFT_c0007785 | 3300000062 | Bacteria | 5563 |
| 114 | JGI24702J35022_10011983 | 3300002462 | Bacteria | 4829 |
| 115 | Ga0068305_10238850 | 3300005083 | Bacteria | 1569 |
| 116 | Ga0466690_108802 | 3300042590 | Bacteria | 9746 |
| 117 | Ga0466692_014388 | 3300042591 | Bacteria | 1451 |
| 118 | Ga0466692_034175 | 3300042591 | Bacteria | 47415 |
| 119 | Ga0466693_312106 | 3300042592 | Bacteria | 1159 |
| 120 | Ga0466691_167761 | 3300042593 | Bacteria | 11914 |
| 121 | Ga0466696_132913 | 3300042596 | Bacteria | 52155 |
| 122 | Ga0466701_010577 | 3300042598 | Bacteria | 16138 |
| 123 | Ga0466735_101150 | 3300042624 | Bacteria | 1138 |
| 124 | Ga0466735_197588 | 3300042624 | Bacteria | 2475 |
| 125 | Ga0466735_198668 | 3300042624 | Bacteria | 3386 |
| 126 | Ga0466704_010086 | 3300042643 | Bacteria | 24092 |
| 127 | Ga0466727_005858 | 3300042655 | Bacteria | 3726 |
| 128 | Ga0466727_224021 | 3300042655 | Bacteria | 8348 |
| 129 | Ga0466705_221960 | 3300042612 | Bacteria | 7432 |
| 130 | Ga0466705_319150 | 3300042612 | Bacteria | 11105 |
| 131 | Ga0466711_109840 | 3300042615 | Bacteria | 3440 |
| 132 | Ga0466715_102980 | 3300042616 | Bacteria | 5879 |
| 133 | Ga0123357_10057285 | 3300009784 | Bacteria | 5237 |
| 134 | Ga0123356_10606404 | 3300010049 | Bacteria | 1260 |
| 135 | Ga0123354_10073347 | 3300010882 | Bacteria | 4918 |
| 136 | Ga0466707_415107 | 3300042601 | Bacteria | 1764 |
| 137 | Ga0466716_527992 | 3300042605 | Bacteria | 9605 |
| 138 | Ga0466719_230412 | 3300042606 | Bacteria | 4442 |
| 139 | Ga0466722_137495 | 3300042609 | Bacteria | 11651 |
| 140 | Ga0466722_182062 | 3300042609 | Bacteria | 36101 |
| 141 | JGI24702J35022_10002850 | 3300002462 | Bacteria | 10470 |
| 142 | JGI24702J35022_10159322 | 3300002462 | Bacteria | 1270 |
| 143 | JGI24705J35276_11916753 | 3300002504 | Bacteria | 764 |
| 144 | Ga0466656_101693 | 3300042550 | Bacteria | 1064 |
| 145 | Ga0466696_001667 | 3300042596 | Bacteria | 9157 |
| 146 | Ga0466729_276956 | 3300042621 | Bacteria | 5396 |
| 147 | Ga0466731_414437 | 3300042622 | Bacteria | 1313 |
| 148 | Ga0466735_118669 | 3300042624 | Bacteria | 4618 |
| 149 | Ga0466703_010097 | 3300042636 | Bacteria | 18623 |
| 150 | Ga0466708_272568 | 3300042652 | Bacteria | 19523 |
| 151 | Ga0466727_163661 | 3300042655 | Bacteria | 23832 |
| 152 | Ga0466727_263657 | 3300042655 | Bacteria | 3372 |
| 153 | Ga0466711_094074 | 3300042615 | Bacteria | 13061 |
| 154 | Ga0466728_154482 | 3300042620 | Bacteria | 34843 |
| 155 | Ga0466728_335093 | 3300042620 | Bacteria | 3178 |
| 156 | Ga0123357_10124858 | 3300009784 | Bacteria | 3228 |
| 157 | Ga0123357_10259981 | 3300009784 | Unclassified | 1837 |
| 158 | Ga0123353_11421746 | 3300010167 | Bacteria | 890 |
| 159 | Ga0123354_10111110 | 3300010882 | Bacteria | 3619 |
| 160 | Ga0466706_164369 | 3300042599 | Bacteria | 4337 |
| 161 | Ga0466707_244703 | 3300042601 | Bacteria | 12788 |
| 162 | Ga0466707_390851 | 3300042601 | Bacteria | 7083 |
| 163 | Ga0466714_087197 | 3300042603 | Bacteria | 6668 |
| 164 | Ga0466716_425765 | 3300042605 | Bacteria | 5927 |
| 165 | Ga0466719_505018 | 3300042606 | Unclassified | 1388 |
| 166 | Ga0466722_113813 | 3300042609 | Bacteria | 8452 |
| 167 | Ga0466722_119429 | 3300042609 | Bacteria | 2554 |
| 168 | Ga0068305_10015691 | 3300005083 | Bacteria | 40812 |
| 169 | Ga0466690_236448 | 3300042590 | Bacteria | 4896 |
| 170 | Ga0466690_332897 | 3300042590 | Bacteria | 1409 |
| 171 | Ga0466693_371971 | 3300042592 | Bacteria | 1664 |
| 172 | Ga0466729_220805 | 3300042621 | Bacteria | 4394 |
| 173 | Ga0466734_054575 | 3300042623 | Bacteria | 1188 |
| 174 | Ga0466735_032460 | 3300042624 | Bacteria | 4001 |
| 175 | Ga0466735_122970 | 3300042624 | Bacteria | 3361 |
| 176 | Ga0466735_162906 | 3300042624 | Bacteria | 4091 |
| 177 | Ga0466703_073148 | 3300042636 | Bacteria | 13833 |
| 178 | Ga0466704_148026 | 3300042643 | Bacteria | 6700 |
| 179 | Ga0466727_101219 | 3300042655 | Bacteria | 84035 |
| 180 | Ga0466697_096684 | 3300042611 | Bacteria | 1520 |
| 181 | Ga0466705_077990 | 3300042612 | Bacteria | 24079 |
| 182 | Ga0466711_127926 | 3300042615 | Bacteria | 20944 |
| 183 | Ga0466715_161567 | 3300042616 | Bacteria | 22971 |
| 184 | Ga0466715_342425 | 3300042616 | Bacteria | 9505 |
| 185 | Ga0466726_347140 | 3300042619 | Bacteria | 3549 |
| 186 | Ga0123357_10252108 | 3300009784 | Unclassified | 1886 |
| 187 | Ga0123357_10646365 | 3300009784 | Unclassified | 785 |
| 188 | Ga0123353_10001011 | 3300010167 | Bacteria | 34432 |
| 189 | Ga0466701_048706 | 3300042598 | Bacteria | 6805 |
| 190 | Ga0466701_097603 | 3300042598 | Bacteria | 1433 |
| 191 | Ga0466707_049391 | 3300042601 | Bacteria | 4924 |
| 192 | Ga0466713_023619 | 3300042602 | Bacteria | 28576 |
| 193 | Ga0466713_136881 | 3300042602 | Bacteria | 5587 |
| 194 | Ga0466719_033039 | 3300042606 | Bacteria | 9504 |
| 195 | Ga0466722_176272 | 3300042609 | Bacteria | 11694 |
| 196 | 2227197484 | 2225789004 | Bacteria | 7797 |
| 197 | IMNBL1DRAFT_c0001056 | 3300000062 | Bacteria | 21318 |
| 198 | IMNBL1DRAFT_c0003499 | 3300000062 | Bacteria | 10055 |
| 199 | JGI24699J35502_11134117 | 3300002509 | Bacteria | 33021 |
| 200 | Ga0068302_10070490 | 3300005071 | Bacteria | 5993 |
| 201 | Ga0068305_10149152 | 3300005083 | Bacteria | 3458 |
| 202 | Ga0072940_1276027 | 3300005200 | Bacteria | 1348 |
| 203 | Ga0123357_10000257 | 3300009784 | Bacteria | 50946 |
| 204 | Ga0466703_314091 | 3300042636 | Bacteria | 6394 |
| 205 | Ga0466697_061765 | 3300042611 | Bacteria | 2339 |
| 206 | Ga0466705_153039 | 3300042612 | Bacteria | 12756 |
| 207 | Ga0466711_031430 | 3300042615 | Bacteria | 20713 |
| 208 | Ga0466728_248996 | 3300042620 | Bacteria | 9129 |
| 209 | Ga0123357_10011075 | 3300009784 | Bacteria | 11534 |
| 210 | Ga0123354_10000424 | 3300010882 | Bacteria | 41153 |
| 211 | Ga0466706_254087 | 3300042599 | Bacteria | 5548 |
| 212 | Ga0466707_102062 | 3300042601 | Bacteria | 8508 |
| 213 | Ga0466707_123761 | 3300042601 | Bacteria | 3045 |
| 214 | Ga0466707_418392 | 3300042601 | Bacteria | 1111 |
| 215 | Ga0466722_043898 | 3300042609 | Bacteria | 8595 |
| 216 | JGI24699J35502_11134146 | 3300002509 | Bacteria | 37464 |
| 217 | JGI24699J35502_11134190 | 3300002509 | Bacteria | 48930 |
| 218 | JGI24696J40584_12959667 | 3300002834 | Bacteria | 5442 |
| 219 | Ga0068302_10042856 | 3300005071 | Bacteria | 6317 |
| 220 | Ga0068302_10317950 | 3300005071 | Bacteria | 1025 |
| 221 | Ga0466690_095011 | 3300042590 | Bacteria | 9755 |
| 222 | Ga0466690_182186 | 3300042590 | Bacteria | 11976 |
| 223 | Ga0466691_080352 | 3300042593 | Bacteria | 30374 |
| 224 | Ga0466694_145525 | 3300042594 | Bacteria | 1355 |
| 225 | Ga0466729_308750 | 3300042621 | Bacteria | 6025 |
| 226 | Ga0466735_087973 | 3300042624 | Bacteria | 1300 |
| 227 | Ga0466703_070729 | 3300042636 | Bacteria | 4268 |
| 228 | Ga0466725_048201 | 3300042654 | Bacteria | 6403 |
| 229 | Ga0466727_017545 | 3300042655 | Bacteria | 24296 |
| 230 | Ga0466727_063045 | 3300042655 | Bacteria | 1599 |
| 231 | Ga0466727_138410 | 3300042655 | Bacteria | 8599 |
| 232 | Ga0466727_166616 | 3300042655 | Bacteria | 25938 |
| 233 | Ga0466727_336449 | 3300042655 | Bacteria | 15356 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.