Protein Family IF06359
Metagenome
Isolate
123
Members
43
Samples
120
Scaffolds
183.28
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_195372|Ga0466716_195372_10771_11388
- Length
- 205 aa
- Sequence
- VPLLFYNLIWKAKKQRKYKIMILPVYLYGHPVLREKAKKVPEDYPALKELVTNMFDTMYHAEGVGLAAPQIGLSMRIIVLDGESLSEDFKECKGFKRVMINPVIEAYNDDETLLEEGCLSLPGIHEKVARATRIQLRYADENWVEHNETIEGFAARIVQHEYEHLDGVVFIDNISAIRRQLNKGKLNNIIKGTANCFYRTKVAGK
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.6%
Termitidae
30.2%
Unclassified
11.6%
Rhinotermitidae
9.3%
Termopsidae
9.3%
Passalidae
4.7%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
1
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 12 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466722_102721 | 3300042609 | Bacteria | 4595 |
| 2 | Ga0466711_137167 | 3300042615 | Bacteria | 3214 |
| 3 | Ga0466711_220936 | 3300042615 | Bacteria | 6473 |
| 4 | Ga0466711_222547 | 3300042615 | Bacteria | 19633 |
| 5 | Ga0466723_270666 | 3300042618 | Bacteria | 14190 |
| 6 | Ga0466723_308413 | 3300042618 | Bacteria | 11603 |
| 7 | Ga0466728_415375 | 3300042620 | Bacteria | 16610 |
| 8 | JGI24702J35022_10075481 | 3300002462 | Bacteria | 1821 |
| 9 | Ga0466731_136263 | 3300042622 | Bacteria | 6846 |
| 10 | Ga0466703_013707 | 3300042636 | Bacteria | 4670 |
| 11 | Ga0466704_420091 | 3300042643 | Bacteria | 1314 |
| 12 | Ga0466708_294636 | 3300042652 | Bacteria | 5143 |
| 13 | Ga0466705_030623 | 3300042612 | Bacteria | 13046 |
| 14 | Ga0123356_10144821 | 3300010049 | Bacteria | 2349 |
| 15 | Ga0123356_11650172 | 3300010049 | Bacteria | 794 |
| 16 | Ga0466707_416341 | 3300042601 | Bacteria | 1542 |
| 17 | Ga0466721_090348 | 3300042608 | Bacteria | 3284 |
| 18 | Ga0466690_294800 | 3300042590 | Bacteria | 12770 |
| 19 | Ga0466711_004876 | 3300042615 | Bacteria | 13509 |
| 20 | Ga0466711_025328 | 3300042615 | Bacteria | 13277 |
| 21 | Ga0466715_186828 | 3300042616 | Bacteria | 12554 |
| 22 | Ga0466726_323795 | 3300042619 | Unclassified | 2166 |
| 23 | Ga0466726_326192 | 3300042619 | Bacteria | 3892 |
| 24 | JGI24702J35022_10022758 | 3300002462 | Bacteria | 3388 |
| 25 | Ga0068302_10199726 | 3300005071 | Bacteria | 1140 |
| 26 | Ga0466703_156959 | 3300042636 | Bacteria | 7438 |
| 27 | Ga0466703_387204 | 3300042636 | Bacteria | 10307 |
| 28 | Ga0466709_184980 | 3300042648 | Bacteria | 1982 |
| 29 | Ga0466709_318574 | 3300042648 | Bacteria | 87877 |
| 30 | Ga0466709_412691 | 3300042648 | Bacteria | 4861 |
| 31 | Ga0466727_274505 | 3300042655 | Bacteria | 4602 |
| 32 | Ga0123353_10501513 | 3300010167 | Bacteria | 1768 |
| 33 | Ga0466706_163843 | 3300042599 | Bacteria | 10543 |
| 34 | Ga0466707_022169 | 3300042601 | Bacteria | 38620 |
| 35 | Ga0466713_121362 | 3300042602 | Bacteria | 1957 |
| 36 | Ga0466722_224877 | 3300042609 | Bacteria | 3202 |
| 37 | Ga0466691_108837 | 3300042593 | Bacteria | 1379 |
| 38 | Ga0466696_212981 | 3300042596 | Bacteria | 16619 |
| 39 | Ga0466705_477699 | 3300042612 | Bacteria | 1544 |
| 40 | Ga0466723_034009 | 3300042618 | Bacteria | 10773 |
| 41 | Ga0466728_009228 | 3300042620 | Bacteria | 30460 |
| 42 | Ga0466728_126349 | 3300042620 | Bacteria | 2136 |
| 43 | JGI24699J35502_11134165 | 3300002509 | Bacteria | 42441 |
| 44 | Ga0068302_10399303 | 3300005071 | Bacteria | 4646 |
| 45 | Ga0466703_213708 | 3300042636 | Bacteria | 3979 |
| 46 | Ga0466704_026770 | 3300042643 | Bacteria | 49720 |
| 47 | Ga0466704_146857 | 3300042643 | Bacteria | 17615 |
| 48 | Ga0466704_168114 | 3300042643 | Bacteria | 1441 |
| 49 | Ga0466727_122414 | 3300042655 | Bacteria | 14741 |
| 50 | Ga0123353_10042494 | 3300010167 | Bacteria | 7189 |
| 51 | Ga0466713_128805 | 3300042602 | Bacteria | 1359 |
| 52 | Ga0466716_401174 | 3300042605 | Bacteria | 2663 |
| 53 | Ga0466721_274579 | 3300042608 | Bacteria | 3902 |
| 54 | Ga0466691_167174 | 3300042593 | Bacteria | 1965 |
| 55 | Ga0466705_400972 | 3300042612 | Bacteria | 7148 |
| 56 | Ga0466711_179642 | 3300042615 | Bacteria | 5855 |
| 57 | Ga0466723_001469 | 3300042618 | Bacteria | 4123 |
| 58 | JGI24696J40584_12566435 | 3300002834 | Bacteria | 635 |
| 59 | Ga0466709_007784 | 3300042648 | Bacteria | 1573 |
| 60 | Ga0466705_262482 | 3300042612 | Bacteria | 1380 |
| 61 | Ga0466733_213658 | 3300042659 | Bacteria | 1608 |
| 62 | Ga0466707_132881 | 3300042601 | Bacteria | 9503 |
| 63 | Ga0466716_422138 | 3300042605 | Bacteria | 1107 |
| 64 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 65 | Ga0466722_243490 | 3300042609 | Bacteria | 14211 |
| 66 | Ga0466698_134018 | 3300042610 | Bacteria | 1360 |
| 67 | Ga0456237_0000036 | 3300041968 | Bacteria | 19939 |
| 68 | Ga0466690_320175 | 3300042590 | Bacteria | 1852 |
| 69 | Ga0466692_128376 | 3300042591 | Bacteria | 43265 |
| 70 | Ga0466691_043152 | 3300042593 | Bacteria | 12747 |
| 71 | Ga0466699_366334 | 3300042597 | Bacteria | 2324 |
| 72 | Ga0466711_408129 | 3300042615 | Bacteria | 10541 |
| 73 | Ga0466723_023862 | 3300042618 | Bacteria | 63714 |
| 74 | Ga0466728_020968 | 3300042620 | Bacteria | 5749 |
| 75 | Ga0068302_10024513 | 3300005071 | Bacteria | 2196 |
| 76 | Ga0068302_10379155 | 3300005071 | Bacteria | 1784 |
| 77 | Ga0466735_203942 | 3300042624 | Bacteria | 4108 |
| 78 | Ga0466709_053373 | 3300042648 | Bacteria | 3333 |
| 79 | Ga0466709_274587 | 3300042648 | Bacteria | 1752 |
| 80 | Ga0466708_120662 | 3300042652 | Bacteria | 21101 |
| 81 | Ga0466708_459966 | 3300042652 | Bacteria | 2969 |
| 82 | Ga0466716_195372 | 3300042605 | Bacteria | 22749 |
| 83 | Ga0466719_448248 | 3300042606 | Bacteria | 2036 |
| 84 | Ga0415639_234961 | 3300038395 | Bacteria | 1554 |
| 85 | Ga0466696_127913 | 3300042596 | Bacteria | 17134 |
| 86 | Ga0466711_062854 | 3300042615 | Bacteria | 3126 |
| 87 | Ga0466715_567151 | 3300042616 | Bacteria | 35252 |
| 88 | Ga0466726_120480 | 3300042619 | Viruses | 2198 |
| 89 | Ga0466728_210135 | 3300042620 | Bacteria | 56087 |
| 90 | IMNBL1DRAFT_c0011605 | 3300000062 | Bacteria | 4101 |
| 91 | Ga0466704_359414 | 3300042643 | Bacteria | 5731 |
| 92 | Ga0466709_180771 | 3300042648 | Bacteria | 2291 |
| 93 | Ga0466727_203370 | 3300042655 | Bacteria | 1958 |
| 94 | Ga0123356_10008475 | 3300010049 | Bacteria | 10222 |
| 95 | Ga0123353_10547584 | 3300010167 | Bacteria | 1670 |
| 96 | Ga0466716_507390 | 3300042605 | Bacteria | 50325 |
| 97 | Ga0466719_326814 | 3300042606 | Unclassified | 1661 |
| 98 | Ga0466722_093816 | 3300042609 | Bacteria | 18976 |
| 99 | Ga0466690_059176 | 3300042590 | Bacteria | 2405 |
| 100 | Ga0466712_192535 | 3300042614 | Bacteria | 6183 |
| 101 | Ga0466715_341502 | 3300042616 | Bacteria | 5907 |
| 102 | Ga0466715_563767 | 3300042616 | Bacteria | 24196 |
| 103 | Ga0466728_013726 | 3300042620 | Bacteria | 9309 |
| 104 | Ga0466728_483734 | 3300042620 | Unclassified | 4709 |
| 105 | Ga0466729_112099 | 3300042621 | Bacteria | 18792 |
| 106 | Ga0466704_245507 | 3300042643 | Bacteria | 3562 |
| 107 | Ga0466727_211103 | 3300042655 | Bacteria | 6528 |
| 108 | Ga0466716_061788 | 3300042605 | Bacteria | 14272 |
| 109 | Ga0466719_430299 | 3300042606 | Unclassified | 2526 |
| 110 | Ga0466690_029345 | 3300042590 | Bacteria | 8622 |
| 111 | Ga0466690_082281 | 3300042590 | Bacteria | 2148 |
| 112 | Ga0466691_205835 | 3300042593 | Bacteria | 1097 |
| 113 | Ga0466723_101325 | 3300042618 | Bacteria | 8442 |
| 114 | Ga0466726_017616 | 3300042619 | Unclassified | 12077 |
| 115 | 2227264150 | 2225789004 | Bacteria | 1293 |
| 116 | JGI24702J35022_10010991 | 3300002462 | Bacteria | 5049 |
| 117 | Ga0466703_160950 | 3300042636 | Bacteria | 8217 |
| 118 | Ga0466703_189332 | 3300042636 | Bacteria | 1588 |
| 119 | Ga0466703_214432 | 3300042636 | Bacteria | 3316 |
| 120 | Ga0466725_173460 | 3300042654 | Bacteria | 1987 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01327 | Pep_deformylase | Polypeptide deformylase | 23 | 179 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01327 | GO:0042586 | peptide deformylase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.