Protein Family IF06318
Metagenome
Isolate
128
Members
54
Samples
113
Scaffolds
408.66
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_068742|Ga0466716_068742_9732_11417
- Length
- 472 aa
- Sequence
- MRPGRRSPHNYFESCGRNSPALYARMNFSASSLVIFAQQRTAWHTSSTQNPVFFYAQKALRYDSCLDIINIFANIKFEYINIFMKTNRRDFLKTLGGIAVFTIVPRHVMGKGFIAPSDQLTKGIIGTGGMGRGHLDYAGTRLVAVCDVDKKHLELGKKLVQDKIAAYHDFRDLILDPNVDIVHIATPPHWHGIMSIEAAKAGKDIWCEKPMTRTIGEGKRVTEAVKQYGRMFRLNTWFRFTDTFYGLGTPVKPLKKLVQSGLLGWPLKVTISKHTGFDWKFYWVGKEYLEPQTIPSELDYDLWLGPAPYKDGGGLGDMGQHYIDPVQYFLGKDHTSPVKVEVDAPQQHPDAVGTWRSITYTYEDDCRIILWGGDYGDPATPYISGPNGNVYKNFVCDIPDWEKKLAIECVNTRQPFALNEQNGFRSATIVNMGAVALRLNRTLHFDPVQLEFINDEAANRLSNQPMRSPWNI
Sample Types
Isolate
11.7%
Metagenome
88.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
29.4%
Kalotermitidae
27.5%
Termitidae
17.6%
Termopsidae
7.8%
Rhinotermitidae
5.9%
Unclassified
5.9%
Hodotermitidae
2.0%
Passalidae
2.0%
Drosophilidae
2.0%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 2 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 3 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 4 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 9 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 10 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 33 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 34 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 35 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 41 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 50 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_191912 | 3300042615 | Bacteria | 7708 |
| 2 | Ga0466711_238034 | 3300042615 | Bacteria | 37187 |
| 3 | Ga0466715_465245 | 3300042616 | Bacteria | 8266 |
| 4 | Ga0466723_318669 | 3300042618 | Bacteria | 11246 |
| 5 | Ga0466729_121703 | 3300042621 | Bacteria | 15107 |
| 6 | Ga0466729_177429 | 3300042621 | Bacteria | 1192 |
| 7 | Ga0466709_218820 | 3300042648 | Bacteria | 3686 |
| 8 | Ga0466724_58157 | 3300042649 | Bacteria | 32184 |
| 9 | Ga0466692_165599 | 3300042591 | Bacteria | 54055 |
| 10 | Ga0466694_370682 | 3300042594 | Unclassified | 2948 |
| 11 | Ga0123353_10064311 | 3300010167 | Unclassified | 5886 |
| 12 | Ga0466707_269407 | 3300042601 | Bacteria | 19464 |
| 13 | IMNBL1DRAFT_c0010396 | 3300000062 | Bacteria | 4462 |
| 14 | JGI24705J35276_12238552 | 3300002504 | Bacteria | 26267 |
| 15 | Ga0466705_180097 | 3300042612 | Bacteria | 7156 |
| 16 | Ga0466703_049266 | 3300042636 | Bacteria | 15884 |
| 17 | Ga0466703_138224 | 3300042636 | Bacteria | 15349 |
| 18 | Ga0466704_102498 | 3300042643 | Bacteria | 21970 |
| 19 | Ga0466708_077253 | 3300042652 | Bacteria | 24343 |
| 20 | Ga0160453_100001 | 3300012814 | Bacteria | 1272344 |
| 21 | Ga0466691_053160 | 3300042593 | Bacteria | 8757 |
| 22 | Ga0466691_057423 | 3300042593 | Bacteria | 8402 |
| 23 | Ga0466716_243171 | 3300042605 | Bacteria | 10481 |
| 24 | Ga0466716_253427 | 3300042605 | Bacteria | 6294 |
| 25 | Ga0466722_022943 | 3300042609 | Bacteria | 5625 |
| 26 | JGI24702J35022_10003336 | 3300002462 | Bacteria | 9693 |
| 27 | Ga0466733_015262 | 3300042659 | Bacteria | 29104 |
| 28 | Ga0466711_335686 | 3300042615 | Bacteria | 9043 |
| 29 | Ga0466715_333374 | 3300042616 | Bacteria | 37993 |
| 30 | Ga0466723_046824 | 3300042618 | Bacteria | 57163 |
| 31 | Ga0466723_154223 | 3300042618 | Bacteria | 18006 |
| 32 | Ga0466735_155860 | 3300042624 | Bacteria | 1304 |
| 33 | Ga0466704_229792 | 3300042643 | Bacteria | 44121 |
| 34 | Ga0466708_112792 | 3300042652 | Bacteria | 43438 |
| 35 | Ga0466727_331820 | 3300042655 | Bacteria | 4077 |
| 36 | Ga0466696_492142 | 3300042596 | Bacteria | 89054 |
| 37 | Ga0160466_100008 | 3300012809 | Bacteria | 463729 |
| 38 | Ga0466714_077690 | 3300042603 | Bacteria | 2366 |
| 39 | Ga0466714_123157 | 3300042603 | Bacteria | 2458 |
| 40 | Ga0466716_427145 | 3300042605 | Bacteria | 20038 |
| 41 | Ga0466719_033990 | 3300042606 | Bacteria | 7178 |
| 42 | Ga0466722_183602 | 3300042609 | Bacteria | 8879 |
| 43 | JGI24702J35022_10046274 | 3300002462 | Bacteria | 2317 |
| 44 | Ga0068305_10112570 | 3300005083 | Bacteria | 4907 |
| 45 | Ga0466733_217490 | 3300042659 | Bacteria | 17628 |
| 46 | Ga0466728_238814 | 3300042620 | Bacteria | 13748 |
| 47 | Ga0466735_114123 | 3300042624 | Bacteria | 2123 |
| 48 | Ga0466735_147422 | 3300042624 | Bacteria | 9059 |
| 49 | Ga0466708_115933 | 3300042652 | Bacteria | 26456 |
| 50 | Ga0466727_164793 | 3300042655 | Unclassified | 1972 |
| 51 | Ga0466690_030845 | 3300042590 | Bacteria | 7785 |
| 52 | Ga0466694_200522 | 3300042594 | Unclassified | 1856 |
| 53 | Ga0466707_311289 | 3300042601 | Bacteria | 2585 |
| 54 | Ga0466713_010899 | 3300042602 | Bacteria | 25756 |
| 55 | Ga0466722_066657 | 3300042609 | Bacteria | 10498 |
| 56 | Ga0104045_1003508 | 3300007085 | Bacteria | 29645 |
| 57 | Ga0466705_249881 | 3300042612 | Unclassified | 2822 |
| 58 | Ga0466733_221141 | 3300042659 | Bacteria | 323281 |
| 59 | Ga0466711_187042 | 3300042615 | Bacteria | 8533 |
| 60 | Ga0466692_120939 | 3300042591 | Bacteria | 20322 |
| 61 | Ga0466694_347426 | 3300042594 | Bacteria | 1441 |
| 62 | Ga0466706_111295 | 3300042599 | Bacteria | 12938 |
| 63 | Ga0466707_062254 | 3300042601 | Bacteria | 4954 |
| 64 | Ga0466707_099354 | 3300042601 | Bacteria | 12143 |
| 65 | Ga0466719_231193 | 3300042606 | Bacteria | 4125 |
| 66 | JGI24702J35022_10000173 | 3300002462 | Bacteria | 33823 |
| 67 | Ga0466715_170213 | 3300042616 | Bacteria | 11367 |
| 68 | Ga0466715_404217 | 3300042616 | Bacteria | 4004 |
| 69 | Ga0466729_146615 | 3300042621 | Bacteria | 2931 |
| 70 | Ga0466703_138518 | 3300042636 | Bacteria | 20083 |
| 71 | Ga0466703_303645 | 3300042636 | Bacteria | 5499 |
| 72 | Ga0466703_378412 | 3300042636 | Bacteria | 12961 |
| 73 | Ga0466704_078614 | 3300042643 | Bacteria | 12503 |
| 74 | Ga0466704_125985 | 3300042643 | Bacteria | 4564 |
| 75 | Ga0466704_174504 | 3300042643 | Bacteria | 9220 |
| 76 | Ga0466704_479980 | 3300042643 | Bacteria | 5894 |
| 77 | Ga0466727_021926 | 3300042655 | Bacteria | 50464 |
| 78 | Ga0466727_064705 | 3300042655 | Bacteria | 4314 |
| 79 | Ga0265387_1000345 | 3300024582 | Bacteria | 7690 |
| 80 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 81 | Ga0466733_163083 | 3300042659 | Bacteria | 18853 |
| 82 | Ga0466715_357790 | 3300042616 | Bacteria | 14955 |
| 83 | Ga0466715_360583 | 3300042616 | Bacteria | 13693 |
| 84 | Ga0466715_472298 | 3300042616 | Bacteria | 24908 |
| 85 | Ga0466715_591623 | 3300042616 | Bacteria | 15648 |
| 86 | Ga0466723_034385 | 3300042618 | Bacteria | 31971 |
| 87 | Ga0466723_272864 | 3300042618 | Unclassified | 6802 |
| 88 | Ga0466726_438807 | 3300042619 | Bacteria | 3372 |
| 89 | Ga0466735_077407 | 3300042624 | Bacteria | 2221 |
| 90 | Ga0466690_202603 | 3300042590 | Bacteria | 13450 |
| 91 | Ga0466693_043257 | 3300042592 | Bacteria | 3589 |
| 92 | Ga0466696_360435 | 3300042596 | Bacteria | 8993 |
| 93 | Ga0123354_10174561 | 3300010882 | Bacteria | 2483 |
| 94 | Ga0466714_012705 | 3300042603 | Bacteria | 2737 |
| 95 | IMNBL1DRAFT_c0002541 | 3300000062 | Bacteria | 12608 |
| 96 | Ga0466705_207794 | 3300042612 | Bacteria | 20507 |
| 97 | Ga0466726_081459 | 3300042619 | Bacteria | 10119 |
| 98 | Ga0466726_228641 | 3300042619 | Bacteria | 3204 |
| 99 | Ga0466726_442653 | 3300042619 | Unclassified | 2364 |
| 100 | Ga0466735_024329 | 3300042624 | Bacteria | 1608 |
| 101 | Ga0466735_092752 | 3300042624 | Bacteria | 6044 |
| 102 | Ga0466727_088458 | 3300042655 | Bacteria | 14738 |
| 103 | Ga0466727_168085 | 3300042655 | Bacteria | 6022 |
| 104 | Ga0466727_228417 | 3300042655 | Bacteria | 24521 |
| 105 | Ga0466693_442265 | 3300042592 | Bacteria | 1158 |
| 106 | Ga0466696_203426 | 3300042596 | Bacteria | 19268 |
| 107 | Ga0466707_123449 | 3300042601 | Bacteria | 5903 |
| 108 | Ga0466707_216781 | 3300042601 | Bacteria | 19756 |
| 109 | Ga0466713_068788 | 3300042602 | Bacteria | 21856 |
| 110 | Ga0466716_068742 | 3300042605 | Bacteria | 11694 |
| 111 | Ga0466716_216590 | 3300042605 | Bacteria | 14194 |
| 112 | Ga0068302_10122751 | 3300005071 | Bacteria | 9629 |
| 113 | Ga0068305_10012806 | 3300005083 | Bacteria | 11631 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.