Protein Family IF06317
Metagenome
Isolate
241
Members
59
Samples
223
Scaffolds
219.52
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_068065|Ga0466716_068065_5474_6247
- Length
- 257 aa
- Sequence
- LRGVVRVQEIVYRGTLKRYGACNVDKFRLYKTPFYVYYSFMEPVIAPSLLSADFSDFFSAVDSIKRAHAEWVHFDVMDGSFVPNLTFGHKLVSDLRSKSDLTFDVHLMVERPERIVPHFIEAGADNITFHVEASVHIQHLLSMIHYGGKKAGLSIVPTTSIAAIEEALPFMDIALIMTVNPGFSGQNMIPQCLEKVKKLVKMREDRGLSFQISVDGGVHTTTARQCIEAGADILVTGSGFFDADDKPALIQKLKGRI
Sample Types
Isolate
7.5%
Metagenome
92.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.1%
Unclassified
31.6%
Kalotermitidae
15.8%
Rhinotermitidae
5.3%
Porcellionidae
1.8%
Hodotermitidae
1.8%
Termopsidae
1.8%
Taxonomy
Archaea
1
Bacteria
224
Eukaryota
0
Viruses
1
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 8073539042 | Candidatus Rhabdochlamydia porcellionis 15C | Isolate | Porcellionidae |
| 8 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 9 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 10 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 11 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 20 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 32 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 33 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 36 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 42 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 43 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 44 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 47 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 48 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 49 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 50 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 57 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 58 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 59 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_344066 | 3300042656 | Bacteria | 9887 |
| 2 | Ga0123355_10001565 | 3300009826 | Bacteria | 31939 |
| 3 | Ga0123356_10000686 | 3300010049 | Bacteria | 37523 |
| 4 | Ga0264413_101187 | 3300024493 | Bacteria | 13404 |
| 5 | Ga0264413_115727 | 3300024493 | Bacteria | 42788 |
| 6 | Ga0415639_033398 | 3300038395 | Bacteria | 11517 |
| 7 | Ga0466694_071545 | 3300042594 | Bacteria | 4056 |
| 8 | Ga0466694_105893 | 3300042594 | Bacteria | 11297 |
| 9 | Ga0466712_162950 | 3300042614 | Bacteria | 3329 |
| 10 | Ga0466718_042189 | 3300042617 | Bacteria | 16646 |
| 11 | Ga0466718_061568 | 3300042617 | Bacteria | 5521 |
| 12 | Ga0466718_117419 | 3300042617 | Bacteria | 1132 |
| 13 | Ga0466718_156217 | 3300042617 | Unclassified | 3265 |
| 14 | Ga0466718_160657 | 3300042617 | Bacteria | 4905 |
| 15 | Ga0466729_016927 | 3300042621 | Bacteria | 5423 |
| 16 | AustNasuHG_c1017037 | 3300000089 | Bacteria | 2422 |
| 17 | JGI24698J34947_10004725 | 3300002449 | Unclassified | 7434 |
| 18 | JGI24698J34947_10005210 | 3300002449 | Unclassified | 7133 |
| 19 | JGI24698J34947_10006538 | 3300002449 | Bacteria | 6397 |
| 20 | JGI24698J34947_10011188 | 3300002449 | Unclassified | 4926 |
| 21 | JGI24698J34947_10093183 | 3300002449 | Bacteria | 1376 |
| 22 | JGI24695J34938_10000606 | 3300002450 | Bacteria | 34450 |
| 23 | JGI24695J34938_10014819 | 3300002450 | Bacteria | 4020 |
| 24 | JGI24695J34938_10128593 | 3300002450 | Bacteria | 1032 |
| 25 | Ga0072940_1003515 | 3300005200 | Bacteria | 6609 |
| 26 | Ga0072941_1001014 | 3300005201 | Bacteria | 35346 |
| 27 | Ga0072941_1130314 | 3300005201 | Bacteria | 3070 |
| 28 | Ga0466706_060638 | 3300042599 | Bacteria | 17599 |
| 29 | Ga0466706_065170 | 3300042599 | Bacteria | 9619 |
| 30 | Ga0466716_097075 | 3300042605 | Bacteria | 5651 |
| 31 | Ga0466720_154336 | 3300042607 | Bacteria | 7951 |
| 32 | Ga0466721_044270 | 3300042608 | Bacteria | 61345 |
| 33 | Ga0466721_235024 | 3300042608 | Bacteria | 41604 |
| 34 | Ga0466732_000623 | 3300042656 | Bacteria | 2771 |
| 35 | Ga0123356_10000128 | 3300010049 | Bacteria | 83646 |
| 36 | Ga0123356_10001872 | 3300010049 | Bacteria | 22802 |
| 37 | Ga0123353_10074608 | 3300010167 | Bacteria | 5452 |
| 38 | Ga0264413_117616 | 3300024493 | Bacteria | 6320 |
| 39 | Ga0466692_172087 | 3300042591 | Bacteria | 21719 |
| 40 | Ga0466694_216220 | 3300042594 | Bacteria | 29786 |
| 41 | Ga0466718_148928 | 3300042617 | Bacteria | 2033 |
| 42 | Ga0466718_157151 | 3300042617 | Bacteria | 39526 |
| 43 | JGI24698J34947_10050961 | 3300002449 | Bacteria | 2085 |
| 44 | JGI24695J34938_10000029 | 3300002450 | Bacteria | 107147 |
| 45 | JGI24695J34938_10000981 | 3300002450 | Bacteria | 25939 |
| 46 | JGI24695J34938_10002544 | 3300002450 | Bacteria | 13776 |
| 47 | JGI24695J34938_10002887 | 3300002450 | Bacteria | 12509 |
| 48 | JGI24695J34938_10008389 | 3300002450 | Bacteria | 5899 |
| 49 | JGI24697J35500_11273584 | 3300002507 | Bacteria | 5798 |
| 50 | Ga0072941_1007440 | 3300005201 | Bacteria | 11162 |
| 51 | Ga0072941_1079031 | 3300005201 | Bacteria | 1199 |
| 52 | Ga0466702_021420 | 3300042635 | Unclassified | 3048 |
| 53 | Ga0466702_101435 | 3300042635 | Bacteria | 10254 |
| 54 | Ga0466702_128724 | 3300042635 | Bacteria | 1041 |
| 55 | Ga0466702_292551 | 3300042635 | Unclassified | 1231 |
| 56 | Ga0466702_354071 | 3300042635 | Bacteria | 21255 |
| 57 | Ga0466707_319311 | 3300042601 | Bacteria | 64740 |
| 58 | Ga0466716_068065 | 3300042605 | Bacteria | 18753 |
| 59 | Ga0466716_155901 | 3300042605 | Bacteria | 4862 |
| 60 | Ga0466720_082804 | 3300042607 | Bacteria | 1922 |
| 61 | Ga0123356_10133758 | 3300010049 | Bacteria | 2434 |
| 62 | Ga0123353_10657186 | 3300010167 | Bacteria | 1482 |
| 63 | Ga0264413_143545 | 3300024493 | Bacteria | 5420 |
| 64 | Ga0466694_006279 | 3300042594 | Bacteria | 29816 |
| 65 | Ga0466695_116291 | 3300042595 | Bacteria | 1162 |
| 66 | Ga0466699_020886 | 3300042597 | Bacteria | 4927 |
| 67 | Ga0466699_236202 | 3300042597 | Bacteria | 1514 |
| 68 | Ga0466712_044803 | 3300042614 | Bacteria | 33552 |
| 69 | Ga0466712_055401 | 3300042614 | Bacteria | 2965 |
| 70 | Ga0466718_063561 | 3300042617 | Bacteria | 1253 |
| 71 | AustNasuHG_c1003075 | 3300000089 | Bacteria | 6020 |
| 72 | JGI24698J34947_10011055 | 3300002449 | Bacteria | 4952 |
| 73 | JGI24695J34938_10000212 | 3300002450 | Bacteria | 55353 |
| 74 | JGI24695J34938_10000506 | 3300002450 | Bacteria | 37879 |
| 75 | JGI24695J34938_10010023 | 3300002450 | Bacteria | 5226 |
| 76 | Ga0072941_1009558 | 3300005201 | Bacteria | 16399 |
| 77 | Ga0072941_1075458 | 3300005201 | Bacteria | 11760 |
| 78 | Ga0466705_033585 | 3300042612 | Bacteria | 5159 |
| 79 | Ga0466731_148321 | 3300042622 | Bacteria | 3694 |
| 80 | Ga0466706_169710 | 3300042599 | Bacteria | 9205 |
| 81 | Ga0466719_246774 | 3300042606 | Bacteria | 3969 |
| 82 | Ga0466720_107940 | 3300042607 | Bacteria | 4337 |
| 83 | Ga0466720_206875 | 3300042607 | Bacteria | 34669 |
| 84 | Ga0123356_10000566 | 3300010049 | Bacteria | 41174 |
| 85 | Ga0415639_090425 | 3300038395 | Archaea | 11854 |
| 86 | Ga0415639_203933 | 3300038395 | Bacteria | 2787 |
| 87 | Ga0466690_234518 | 3300042590 | Bacteria | 5260 |
| 88 | Ga0466712_155352 | 3300042614 | Bacteria | 28394 |
| 89 | Ga0466718_077289 | 3300042617 | Bacteria | 5168 |
| 90 | Ga0466723_013515 | 3300042618 | Bacteria | 3274 |
| 91 | JGI24698J34947_10006979 | 3300002449 | Bacteria | 6208 |
| 92 | JGI24698J34947_10030078 | 3300002449 | Bacteria | 2866 |
| 93 | JGI24698J34947_10066724 | 3300002449 | Bacteria | 1750 |
| 94 | JGI24695J34938_10000043 | 3300002450 | Bacteria | 94696 |
| 95 | JGI24695J34938_10000093 | 3300002450 | Bacteria | 78486 |
| 96 | JGI24695J34938_10000469 | 3300002450 | Bacteria | 39072 |
| 97 | JGI24695J34938_10000600 | 3300002450 | Bacteria | 34638 |
| 98 | JGI24695J34938_10051709 | 3300002450 | Bacteria | 1796 |
| 99 | Ga0072940_1027312 | 3300005200 | Bacteria | 3286 |
| 100 | Ga0466735_193468 | 3300042624 | Bacteria | 1326 |
| 101 | Ga0466702_433488 | 3300042635 | Bacteria | 1951 |
| 102 | Ga0466704_323750 | 3300042643 | Bacteria | 24846 |
| 103 | Ga0466706_007476 | 3300042599 | Bacteria | 12147 |
| 104 | Ga0466717_182391 | 3300042604 | Bacteria | 2133 |
| 105 | Ga0466720_209107 | 3300042607 | Bacteria | 1066 |
| 106 | Ga0466733_141867 | 3300042659 | Bacteria | 123412 |
| 107 | Ga0123356_10000086 | 3300010049 | Bacteria | 97047 |
| 108 | Ga0264413_110847 | 3300024493 | Bacteria | 11792 |
| 109 | Ga0456237_0000826 | 3300041968 | Bacteria | 4831 |
| 110 | Ga0466693_100441 | 3300042592 | Bacteria | 6530 |
| 111 | Ga0466694_250017 | 3300042594 | Unclassified | 3140 |
| 112 | Ga0466699_062398 | 3300042597 | Bacteria | 5989 |
| 113 | Ga0466699_152772 | 3300042597 | Viruses | 3271 |
| 114 | Ga0466712_112888 | 3300042614 | Unclassified | 6248 |
| 115 | Ga0466712_120889 | 3300042614 | Bacteria | 6364 |
| 116 | Ga0466712_131875 | 3300042614 | Unclassified | 15358 |
| 117 | Ga0466712_146402 | 3300042614 | Bacteria | 27754 |
| 118 | Ga0466712_153463 | 3300042614 | Bacteria | 22828 |
| 119 | Ga0466712_298833 | 3300042614 | Bacteria | 28317 |
| 120 | Ga0466718_003641 | 3300042617 | Bacteria | 67531 |
| 121 | Ga0466718_031491 | 3300042617 | Bacteria | 6205 |
| 122 | Ga0466718_065876 | 3300042617 | Bacteria | 7057 |
| 123 | Ga0466718_079626 | 3300042617 | Bacteria | 8484 |
| 124 | AustNasuHG_c1016076 | 3300000089 | Bacteria | 2511 |
| 125 | JGI24698J34947_10000605 | 3300002449 | Bacteria | 17193 |
| 126 | JGI24698J34947_10000943 | 3300002449 | Bacteria | 14815 |
| 127 | JGI24698J34947_10006477 | 3300002449 | Bacteria | 6423 |
| 128 | JGI24698J34947_10008608 | 3300002449 | Bacteria | 5600 |
| 129 | JGI24698J34947_10014010 | 3300002449 | Bacteria | 4369 |
| 130 | JGI24698J34947_10096613 | 3300002449 | Bacteria | 1340 |
| 131 | JGI24695J34938_10000009 | 3300002450 | Bacteria | 135235 |
| 132 | JGI24695J34938_10008847 | 3300002450 | Bacteria | 5692 |
| 133 | Ga0072941_1014394 | 3300005201 | Bacteria | 9375 |
| 134 | Ga0466702_433675 | 3300042635 | Bacteria | 1316 |
| 135 | Ga0466708_410858 | 3300042652 | Bacteria | 17679 |
| 136 | Ga0466698_394074 | 3300042610 | Bacteria | 36879 |
| 137 | Ga0466732_024385 | 3300042656 | Bacteria | 10909 |
| 138 | Ga0123356_10000215 | 3300010049 | Bacteria | 67385 |
| 139 | Ga0123356_10001103 | 3300010049 | Bacteria | 29965 |
| 140 | Ga0123356_10001956 | 3300010049 | Bacteria | 22301 |
| 141 | Ga0123356_10002080 | 3300010049 | Bacteria | 21599 |
| 142 | Ga0123356_10296992 | 3300010049 | Bacteria | 1719 |
| 143 | Ga0415639_008521 | 3300038395 | Bacteria | 3685 |
| 144 | Ga0466694_093765 | 3300042594 | Bacteria | 40261 |
| 145 | Ga0466694_161345 | 3300042594 | Bacteria | 5511 |
| 146 | Ga0466712_022202 | 3300042614 | Bacteria | 13403 |
| 147 | Ga0466712_075669 | 3300042614 | Bacteria | 5111 |
| 148 | Ga0466712_166641 | 3300042614 | Bacteria | 6004 |
| 149 | Ga0466712_195148 | 3300042614 | Bacteria | 34102 |
| 150 | Ga0466718_006286 | 3300042617 | Bacteria | 3331 |
| 151 | Ga0466718_076035 | 3300042617 | Bacteria | 62220 |
| 152 | Ga0466718_129132 | 3300042617 | Bacteria | 7175 |
| 153 | JGI24698J34947_10011172 | 3300002449 | Unclassified | 4928 |
| 154 | JGI24698J34947_10055334 | 3300002449 | Bacteria | 1977 |
| 155 | JGI24695J34938_10000006 | 3300002450 | Bacteria | 141807 |
| 156 | JGI24695J34938_10000015 | 3300002450 | Bacteria | 118711 |
| 157 | JGI24695J34938_10000042 | 3300002450 | Bacteria | 95222 |
| 158 | JGI24695J34938_10000318 | 3300002450 | Bacteria | 47262 |
| 159 | JGI24695J34938_10007266 | 3300002450 | Bacteria | 6523 |
| 160 | JGI24695J34938_10009214 | 3300002450 | Bacteria | 5507 |
| 161 | Ga0072940_1004463 | 3300005200 | Bacteria | 7617 |
| 162 | Ga0072941_1001015 | 3300005201 | Bacteria | 29653 |
| 163 | Ga0072941_1006843 | 3300005201 | Bacteria | 12333 |
| 164 | Ga0072941_1038230 | 3300005201 | Bacteria | 7075 |
| 165 | Ga0466731_419060 | 3300042622 | Bacteria | 7125 |
| 166 | Ga0466706_245164 | 3300042599 | Bacteria | 20608 |
| 167 | Ga0466720_071041 | 3300042607 | Bacteria | 11110 |
| 168 | Ga0466720_107771 | 3300042607 | Bacteria | 24087 |
| 169 | Ga0466720_142335 | 3300042607 | Bacteria | 2671 |
| 170 | Ga0466720_198076 | 3300042607 | Bacteria | 2478 |
| 171 | Ga0466732_184860 | 3300042656 | Bacteria | 2491 |
| 172 | Ga0466693_011947 | 3300042592 | Bacteria | 23821 |
| 173 | Ga0466691_050304 | 3300042593 | Bacteria | 8336 |
| 174 | Ga0466694_168330 | 3300042594 | Bacteria | 12586 |
| 175 | Ga0466694_207936 | 3300042594 | Bacteria | 26092 |
| 176 | Ga0466696_033754 | 3300042596 | Bacteria | 10098 |
| 177 | Ga0466699_015973 | 3300042597 | Bacteria | 123791 |
| 178 | Ga0466699_048858 | 3300042597 | Bacteria | 31462 |
| 179 | Ga0466712_072640 | 3300042614 | Bacteria | 11688 |
| 180 | Ga0466718_049588 | 3300042617 | Bacteria | 3556 |
| 181 | Ga0466718_051535 | 3300042617 | Bacteria | 25600 |
| 182 | Ga0466718_069300 | 3300042617 | Bacteria | 2600 |
| 183 | Ga0466723_076040 | 3300042618 | Bacteria | 2870 |
| 184 | Ga0466723_162003 | 3300042618 | Unclassified | 2218 |
| 185 | AustNasuHG_c1003769 | 3300000089 | Unclassified | 5468 |
| 186 | JGI24698J34947_10001260 | 3300002449 | Unclassified | 13257 |
| 187 | JGI24698J34947_10009080 | 3300002449 | Bacteria | 5455 |
| 188 | JGI24698J34947_10017485 | 3300002449 | Bacteria | 3885 |
| 189 | Ga0072941_1004868 | 3300005201 | Bacteria | 22370 |
| 190 | Ga0072941_1038245 | 3300005201 | Bacteria | 3023 |
| 191 | Ga0466706_203507 | 3300042599 | Bacteria | 9146 |
| 192 | Ga0466706_253685 | 3300042599 | Bacteria | 17982 |
| 193 | Ga0466732_392270 | 3300042656 | Bacteria | 13329 |
| 194 | Ga0264413_101189 | 3300024493 | Unclassified | 2142 |
| 195 | Ga0415639_109452 | 3300038395 | Bacteria | 2944 |
| 196 | Ga0466693_182488 | 3300042592 | Bacteria | 1613 |
| 197 | Ga0466693_437327 | 3300042592 | Bacteria | 95896 |
| 198 | Ga0466694_005012 | 3300042594 | Bacteria | 2726 |
| 199 | Ga0466694_032099 | 3300042594 | Bacteria | 1301 |
| 200 | Ga0466694_121308 | 3300042594 | Bacteria | 3247 |
| 201 | Ga0466696_305045 | 3300042596 | Bacteria | 7712 |
| 202 | Ga0466699_116562 | 3300042597 | Bacteria | 1305 |
| 203 | Ga0466712_058023 | 3300042614 | Bacteria | 14851 |
| 204 | Ga0466712_091130 | 3300042614 | Bacteria | 23740 |
| 205 | Ga0466718_012738 | 3300042617 | Bacteria | 1042 |
| 206 | Ga0466718_072502 | 3300042617 | Bacteria | 17918 |
| 207 | Ga0466718_126017 | 3300042617 | Unclassified | 2691 |
| 208 | Ga0466718_155471 | 3300042617 | Bacteria | 3456 |
| 209 | AustNasuHG_c1000010 | 3300000089 | Bacteria | 53411 |
| 210 | JGI24695J34938_10001064 | 3300002450 | Bacteria | 24848 |
| 211 | JGI24695J34938_10105953 | 3300002450 | Bacteria | 1147 |
| 212 | JGI24699J35502_11126266 | 3300002509 | Bacteria | 3932 |
| 213 | Ga0072940_1027311 | 3300005200 | Bacteria | 4354 |
| 214 | Ga0072941_1005800 | 3300005201 | Bacteria | 35925 |
| 215 | Ga0072941_1028811 | 3300005201 | Bacteria | 13758 |
| 216 | Ga0072941_1028812 | 3300005201 | Bacteria | 5045 |
| 217 | Ga0072941_1152167 | 3300005201 | Bacteria | 3612 |
| 218 | Ga0466729_315878 | 3300042621 | Bacteria | 1044 |
| 219 | Ga0466731_420759 | 3300042622 | Bacteria | 1954 |
| 220 | Ga0466735_143966 | 3300042624 | Bacteria | 10952 |
| 221 | Ga0466735_154427 | 3300042624 | Bacteria | 1978 |
| 222 | Ga0466706_235490 | 3300042599 | Bacteria | 25974 |
| 223 | Ga0466720_174322 | 3300042607 | Bacteria | 33636 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00834 | Ribul_P_3_epim | Ribulose-phosphate 3 epimerase family | 45 | 241 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.