Protein Family IF06266

Metagenome Metatranscriptome Isolate
136 Members
51 Samples
119 Scaffolds
112.49 Avg Length

🧬 Representative Sequence

ID
3300042604|Ga0466717_125060|Ga0466717_125060_418_810
Length
130 aa
Sequence
VSVKFSNKNVAKKSVKLHVKTGDTVVLLTGKYKDKFSKPGVRKTGKVVGVSPKEGKVIVEGINKVKKHVKPRRAGEPGGIIDAEAPIYACKVQVVCPKCDKPTRVGHGFKEVKGKTVKVRICKKCGKEID

📊 Sample Types

Isolate 12.5%
Metagenome 85.3%
MAG 0.0%
Metatranscriptome 2.2%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 36.0%
Termitidae 36.0%
Kalotermitidae 18.0%
Passalidae 4.0%
Apidae 2.0%
Termopsidae 2.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
2 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
9 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
18 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
19 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
20 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
21 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
22 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
23 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
24 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
25 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
26 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
27 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
28 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
29 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
35 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
36 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
37 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
38 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
42 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
43 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
44 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
45 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
46 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
47 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
48 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
49 3300021237 Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA Metatranscriptome
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 3300021240 Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_028737 3300042659 Bacteria 2352
2 Ga0466717_261825 3300042604 Bacteria 1083
3 Ga0466721_218303 3300042608 Bacteria 3036
4 Ga0123355_10202642 3300009826 Bacteria 2894
5 Ga0123355_11654190 3300009826 Bacteria 613
6 Ga0123356_10102388 3300010049 Bacteria 2749
7 Ga0123353_10000033 3300010167 Bacteria 150421
8 Ga0123353_10007664 3300010167 Bacteria 14629
9 Ga0123353_11855508 3300010167 Bacteria 746
10 Ga0123353_12394458 3300010167 Bacteria 632
11 Ga0466704_322227 3300042643 Bacteria 202158
12 2227459968 2225789004 Unclassified 1004
13 IMNBL1DRAFT_c0001685 3300000062 Bacteria 16309
14 Ga0072940_1122815 3300005200 Bacteria 5983
15 Ga0415639_007671 3300038395 Bacteria 5926
16 Ga0415639_020367 3300038395 Bacteria 13306
17 Ga0466733_188704 3300042659 Bacteria 2246
18 Ga0466706_215819 3300042599 Bacteria 3628
19 Ga0123355_10439067 3300009826 Bacteria 1654
20 Ga0123355_10639348 3300009826 Bacteria 1246
21 Ga0123355_11828410 3300009826 Unclassified 572
22 Ga0123356_10145829 3300010049 Bacteria 2342
23 Ga0123356_11914877 3300010049 Unclassified 738
24 Ga0123356_13643137 3300010049 Bacteria 533
25 Ga0123353_10230863 3300010167 Bacteria 2885
26 Ga0123353_11296389 3300010167 Bacteria 946
27 Ga0123353_13364003 3300010167 Bacteria 508
28 Ga0466702_180988 3300042635 Bacteria 12693
29 IMNBL1DRAFT_c0003704 3300000062 Bacteria 9614
30 Ga0068302_10222330 3300005071 Bacteria 1640
31 Ga0415639_007670 3300038395 Bacteria 6074
32 Ga0415639_019174 3300038395 Bacteria 27021
33 Ga0415639_101338 3300038395 Bacteria 1061
34 Ga0466710_395115 3300042613 Bacteria 1440
35 Ga0466706_269670 3300042599 Bacteria 79639
36 Ga0466721_147266 3300042608 Bacteria 1195
37 Ga0466698_337884 3300042610 Bacteria 12427
38 Ga0123355_10297031 3300009826 Bacteria 2208
39 Ga0123355_10349552 3300009826 Bacteria 1960
40 Ga0123355_10485176 3300009826 Bacteria 1535
41 Ga0123355_10548431 3300009826 Bacteria 1399
42 Ga0123356_10000028 3300010049 Bacteria 164875
43 Ga0123356_10075868 3300010049 Bacteria 3167
44 Ga0123356_11359798 3300010049 Bacteria 872
45 Ga0123356_11539559 3300010049 Bacteria 821
46 Ga0123356_13749558 3300010049 Bacteria 525
47 Ga0123353_10595986 3300010167 Bacteria 1581
48 Ga0123353_10660638 3300010167 Bacteria 1477
49 Ga0123354_10138730 3300010882 Bacteria 3023
50 AustNasuHG_c1000039 3300000089 Bacteria 32381
51 Ga0223675_1033352 3300021237 Bacteria 1048
52 Ga0415639_001087 3300038395 Bacteria 37853
53 Ga0466706_284824 3300042599 Bacteria 3250
54 Ga0466700_448226 3300042600 Bacteria 2117
55 Ga0466714_034189 3300042603 Bacteria 4534
56 Ga0466721_171853 3300042608 Bacteria 2182
57 Ga0123355_10871362 3300009826 Bacteria 986
58 Ga0123356_10233862 3300010049 Bacteria 1904
59 Ga0123356_10246161 3300010049 Bacteria 1862
60 Ga0123356_11101699 3300010049 Bacteria 962
61 Ga0123356_11802553 3300010049 Bacteria 761
62 Ga0466702_125533 3300042635 Bacteria 57100
63 Ga0072940_1122814 3300005200 Bacteria 2972
64 Ga0466728_184948 3300042620 Bacteria 2550
65 Ga0466733_215673 3300042659 Bacteria 10596
66 Ga0466707_329910 3300042601 Bacteria 3613
67 Ga0466714_122492 3300042603 Bacteria 2757
68 Ga0123356_11682661 3300010049 Bacteria 787
69 Ga0466702_447794 3300042635 Bacteria 1991
70 2227469098 2225789004 Bacteria 4980
71 JGI24703J35330_11748856 3300002501 Bacteria 55836
72 Ga0068305_10005402 3300005083 Bacteria 29409
73 Ga0415639_170993 3300038395 Bacteria 1155
74 Ga0466715_155843 3300042616 Bacteria 19455
75 Ga0466733_130542 3300042659 Bacteria 2239
76 Ga0466706_123050 3300042599 Bacteria 2733
77 Ga0466700_321744 3300042600 Bacteria 1581
78 Ga0466717_125060 3300042604 Bacteria 2040
79 Ga0466717_289737 3300042604 Bacteria 1024
80 Ga0466698_428023 3300042610 Bacteria 1317
81 Ga0123355_10077171 3300009826 Bacteria 5326
82 Ga0123355_10137124 3300009826 Bacteria 3755
83 Ga0123355_10410645 3300009826 Bacteria 1738
84 Ga0123355_11665138 3300009826 Bacteria 610
85 Ga0123356_10204096 3300010049 Unclassified 2019
86 Ga0123356_10218072 3300010049 Bacteria 1962
87 Ga0123353_10913744 3300010167 Bacteria 1193
88 Ga0123353_12949044 3300010167 Bacteria 553
89 Ga0466703_190061 3300042636 Bacteria 90552
90 2227505172 2225789004 Bacteria 19004
91 Ga0072940_1122816 3300005200 Bacteria 2618
92 Ga0072940_1383219 3300005200 Bacteria 893
93 Ga0466696_498562 3300042596 Bacteria 15998
94 Ga0466706_100462 3300042599 Bacteria 36169
95 Ga0466714_094629 3300042603 Bacteria 1559
96 Ga0123355_10002185 3300009826 Bacteria 27609
97 Ga0123355_10276546 3300009826 Bacteria 2324
98 Ga0123356_13495359 3300010049 Bacteria 545
99 Ga0123353_10012761 3300010167 Bacteria 11980
100 Ga0123353_10957124 3300010167 Bacteria 1157
101 Ga0466709_171547 3300042648 Bacteria 83571
102 Ga0233288_1017964 3300022232 Bacteria 2320
103 Ga0415639_121180 3300038395 Bacteria 3675
104 Ga0466716_079119 3300042605 Bacteria 3655
105 Ga0466719_201247 3300042606 Bacteria 254275
106 Ga0123355_10938058 3300009826 Bacteria 932
107 Ga0123356_10005392 3300010049 Bacteria 13028
108 Ga0123356_13236283 3300010049 Unclassified 567
109 Ga0123353_10005887 3300010167 Bacteria 16213
110 Ga0123353_10013104 3300010167 Bacteria 11852
111 Ga0123353_10503773 3300010167 Bacteria 1763
112 Ga0123353_10836425 3300010167 Bacteria 1264
113 IMNBL1DRAFT_c0001208 3300000062 Bacteria 19538
114 Ga0223684_1088824 3300021240 Bacteria 702
115 Ga0415639_012149 3300038395 Bacteria 25902
116 Ga0415639_065900 3300038395 Bacteria 3879
117 Ga0466691_066147 3300042593 Bacteria 2053
118 Ga0466696_296201 3300042596 Bacteria 26567
119 Ga0466715_584084 3300042616 Bacteria 48896

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17136 ribosomal_L24 Ribosomal proteins 50S L24/mitochondrial 39S L24 62 129 0.95

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.