Protein Family IF06245
Metagenome
Isolate
129
Members
37
Samples
121
Scaffolds
146.42
Avg Length
Representative Sequence
- ID
- 3300042604|Ga0466717_023778|Ga0466717_023778_821_1249
- Length
- 142 aa
- Sequence
- MDKKYICYCGLYCGNCAVKVKVEPASKVLYDEMKKAGFEDILPMLPGGDHFWSFLQGMVQGVCISCQEGSGNPHCAVRTCAKEKNVEMCAICEDYPCALFARYFEGYPILKQDNALMRDEGMEAWSELQDERRACGFTYAGE
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
72.2%
Unclassified
22.2%
Passalidae
5.6%
Taxonomy
Archaea
29
Bacteria
76
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 2 | 2772190993 | Unclassified Euryarchaeota Lab288P4bin101 | Isolate | Unclassified |
| 3 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 13 | 2820023741 | Unclassified Spirochaetes Lab288P3bin165 | Isolate | Unclassified |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 2773857696 | Unclassified Methanomassiliicoccaceae Th196P4bin4 | Isolate | Unclassified |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 36 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_049584 | 3300042598 | Bacteria | 2221 |
| 2 | Ga0466657_295106 | 3300042582 | Bacteria | 1065 |
| 3 | Ga0466694_364403 | 3300042594 | Archaea | 2376 |
| 4 | 2227481629 | 2225789004 | Archaea | 845 |
| 5 | IMNBL1DRAFT_c0022518 | 3300000062 | Archaea | 2491 |
| 6 | IMNBL1DRAFT_c0033265 | 3300000062 | Archaea | 1848 |
| 7 | JGI24702J35022_10018522 | 3300002462 | Unclassified | 3796 |
| 8 | JGI24705J35276_11878806 | 3300002504 | Unclassified | 735 |
| 9 | JGI24705J35276_11981304 | 3300002504 | Bacteria | 826 |
| 10 | Ga0123357_10203249 | 3300009784 | Bacteria | 2248 |
| 11 | Ga0123357_10259137 | 3300009784 | Bacteria | 1842 |
| 12 | Ga0123356_10665926 | 3300010049 | Bacteria | 1208 |
| 13 | Ga0123356_12452274 | 3300010049 | Archaea | 653 |
| 14 | Ga0123353_10004872 | 3300010167 | Bacteria | 17444 |
| 15 | Ga0123353_10042127 | 3300010167 | Bacteria | 7218 |
| 16 | Ga0466710_439096 | 3300042613 | Bacteria | 1814 |
| 17 | Ga0466701_046807 | 3300042598 | Bacteria | 31801 |
| 18 | Ga0466717_023778 | 3300042604 | Bacteria | 1685 |
| 19 | Ga0466694_005611 | 3300042594 | Unclassified | 1127 |
| 20 | Ga0466694_271902 | 3300042594 | Bacteria | 1516 |
| 21 | Ga0466695_398725 | 3300042595 | Bacteria | 1243 |
| 22 | Ga0466699_093432 | 3300042597 | Bacteria | 6161 |
| 23 | IMNBL1DRAFT_c0017307 | 3300000062 | Unclassified | 3040 |
| 24 | IMNBL1DRAFT_c0075590 | 3300000062 | Archaea | 957 |
| 25 | JGI24702J35022_10094785 | 3300002462 | Archaea | 1628 |
| 26 | JGI24702J35022_10113728 | 3300002462 | Unclassified | 1490 |
| 27 | JGI24705J35276_11980231 | 3300002504 | Archaea | 825 |
| 28 | JGI24705J35276_11995349 | 3300002504 | Bacteria | 842 |
| 29 | JGI24705J35276_12139816 | 3300002504 | Archaea | 1136 |
| 30 | JGI24705J35276_12210340 | 3300002504 | Unclassified | 1823 |
| 31 | JGI24699J35502_10822855 | 3300002509 | Bacteria | 911 |
| 32 | Ga0123356_10006551 | 3300010049 | Bacteria | 11734 |
| 33 | Ga0123353_10000851 | 3300010167 | Bacteria | 37039 |
| 34 | Ga0123353_10019454 | 3300010167 | Unclassified | 10090 |
| 35 | Ga0123353_11014565 | 3300010167 | Unclassified | 1113 |
| 36 | Ga0466710_200146 | 3300042613 | Unclassified | 2654 |
| 37 | Ga0466700_343472 | 3300042600 | Bacteria | 2600 |
| 38 | Ga0466717_017552 | 3300042604 | Archaea | 1597 |
| 39 | Ga0466717_260282 | 3300042604 | Bacteria | 1932 |
| 40 | Ga0466698_125975 | 3300042610 | Archaea | 1228 |
| 41 | IMNBL1DRAFT_c0001780 | 3300000062 | Archaea | 15766 |
| 42 | JGI24702J35022_10086574 | 3300002462 | Bacteria | 1701 |
| 43 | JGI24699J35502_11133977 | 3300002509 | Unclassified | 22353 |
| 44 | JGI24696J40584_12952743 | 3300002834 | Bacteria | 2386 |
| 45 | Ga0123353_11368229 | 3300010167 | Bacteria | 913 |
| 46 | Ga0123353_12323938 | 3300010167 | Bacteria | 644 |
| 47 | Ga0123353_12711921 | 3300010167 | Archaea | 583 |
| 48 | Ga0466731_161930 | 3300042622 | Bacteria | 1054 |
| 49 | Ga0466701_051634 | 3300042598 | Bacteria | 1761 |
| 50 | Ga0466701_101211 | 3300042598 | Bacteria | 1961 |
| 51 | 2227286364 | 2225789004 | Archaea | 6738 |
| 52 | JGI24702J35022_10023819 | 3300002462 | Unclassified | 3309 |
| 53 | Ga0123354_10377676 | 3300010882 | Bacteria | 1228 |
| 54 | Ga0123354_10865497 | 3300010882 | Archaea | 598 |
| 55 | Ga0466697_206180 | 3300042611 | Bacteria | 1021 |
| 56 | Ga0466721_191836 | 3300042608 | Bacteria | 4517 |
| 57 | Ga0466693_025967 | 3300042592 | Bacteria | 1630 |
| 58 | JGI24705J35276_12131594 | 3300002504 | Archaea | 1107 |
| 59 | JGI24705J35276_12237584 | 3300002504 | Bacteria | 11926 |
| 60 | JGI24699J35502_11133988 | 3300002509 | Bacteria | 23025 |
| 61 | JGI24696J40584_12925212 | 3300002834 | Bacteria | 1397 |
| 62 | Ga0123357_10132948 | 3300009784 | Bacteria | 3089 |
| 63 | Ga0123356_10108730 | 3300010049 | Bacteria | 2674 |
| 64 | Ga0123356_10659684 | 3300010049 | Unclassified | 1214 |
| 65 | Ga0123356_10891866 | 3300010049 | Bacteria | 1060 |
| 66 | Ga0123356_12015576 | 3300010049 | Bacteria | 720 |
| 67 | Ga0123353_10057203 | 3300010167 | Bacteria | 6245 |
| 68 | Ga0123353_10082001 | 3300010167 | Bacteria | 5187 |
| 69 | Ga0123353_10106174 | 3300010167 | Archaea | 4525 |
| 70 | Ga0123353_11119785 | 3300010167 | Archaea | 1043 |
| 71 | Ga0466731_290183 | 3300042622 | Bacteria | 1295 |
| 72 | Ga0466710_095855 | 3300042613 | Bacteria | 1456 |
| 73 | Ga0466718_093430 | 3300042617 | Bacteria | 2570 |
| 74 | Ga0466700_013685 | 3300042600 | Bacteria | 1619 |
| 75 | Ga0466697_032689 | 3300042611 | Bacteria | 1739 |
| 76 | Ga0466656_045994 | 3300042550 | Bacteria | 1569 |
| 77 | Ga0466656_192070 | 3300042550 | Bacteria | 1169 |
| 78 | Ga0466694_083558 | 3300042594 | Unclassified | 2502 |
| 79 | IMNBL1DRAFT_c0001526 | 3300000062 | Bacteria | 17247 |
| 80 | JGI24702J35022_10008560 | 3300002462 | Bacteria | 5789 |
| 81 | JGI24702J35022_10012231 | 3300002462 | Bacteria | 4774 |
| 82 | JGI24702J35022_10023419 | 3300002462 | Bacteria | 3339 |
| 83 | JGI24702J35022_10042694 | 3300002462 | Bacteria | 2415 |
| 84 | JGI24702J35022_10139693 | 3300002462 | Archaea | 1351 |
| 85 | Ga0123356_10839622 | 3300010049 | Unclassified | 1090 |
| 86 | Ga0123356_11509396 | 3300010049 | Bacteria | 829 |
| 87 | Ga0123353_10754855 | 3300010167 | Bacteria | 1353 |
| 88 | Ga0123354_10000382 | 3300010882 | Bacteria | 42285 |
| 89 | Ga0123354_10037858 | 3300010882 | Archaea | 7501 |
| 90 | Ga0466697_064992 | 3300042611 | Unclassified | 1043 |
| 91 | Ga0466697_187311 | 3300042611 | Bacteria | 1156 |
| 92 | Ga0466731_154045 | 3300042622 | Unclassified | 2560 |
| 93 | Ga0466700_290857 | 3300042600 | Archaea | 1357 |
| 94 | Ga0466717_044363 | 3300042604 | Unclassified | 1899 |
| 95 | Ga0466717_080463 | 3300042604 | Unclassified | 1343 |
| 96 | Ga0466717_195429 | 3300042604 | Archaea | 1017 |
| 97 | Ga0466698_263769 | 3300042610 | Bacteria | 1340 |
| 98 | IMNBL1DRAFT_c0007958 | 3300000062 | Archaea | 5476 |
| 99 | JGI24702J35022_10030383 | 3300002462 | Bacteria | 2899 |
| 100 | Ga0123355_10417042 | 3300009826 | Unclassified | 1719 |
| 101 | Ga0123355_10929944 | 3300009826 | Unclassified | 938 |
| 102 | Ga0123356_11764261 | 3300010049 | Bacteria | 769 |
| 103 | Ga0123353_10928999 | 3300010167 | Unclassified | 1180 |
| 104 | Ga0123353_11462290 | 3300010167 | Archaea | 873 |
| 105 | Ga0123354_10522313 | 3300010882 | Bacteria | 912 |
| 106 | Ga0466697_128213 | 3300042611 | Bacteria | 10303 |
| 107 | Ga0466710_282066 | 3300042613 | Archaea | 1381 |
| 108 | Ga0466712_039463 | 3300042614 | Bacteria | 1002 |
| 109 | Ga0466700_084051 | 3300042600 | Bacteria | 1523 |
| 110 | Ga0466714_079264 | 3300042603 | Bacteria | 1046 |
| 111 | Ga0466717_119590 | 3300042604 | Unclassified | 1223 |
| 112 | Ga0466699_343746 | 3300042597 | Bacteria | 1013 |
| 113 | JGI24702J35022_10043424 | 3300002462 | Bacteria | 2394 |
| 114 | JGI24702J35022_10078161 | 3300002462 | Bacteria | 1790 |
| 115 | JGI24702J35022_10147149 | 3300002462 | Bacteria | 1319 |
| 116 | JGI24705J35276_12203881 | 3300002504 | Unclassified | 1665 |
| 117 | Ga0072941_1262477 | 3300005201 | Archaea | 823 |
| 118 | Ga0123356_10468840 | 3300010049 | Archaea | 1410 |
| 119 | Ga0123353_10040742 | 3300010167 | Bacteria | 7330 |
| 120 | Ga0123353_10909131 | 3300010167 | Unclassified | 1197 |
| 121 | Ga0466712_103470 | 3300042614 | Bacteria | 1499 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF12675 | DUF3795 | Protein of unknown function (DUF3795) | 6 | 100 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.