Protein Family IF06241
Metagenome
Isolate
230
Members
95
Samples
183
Scaffolds
329.51
Avg Length
Representative Sequence
- ID
- 3300042603|Ga0466714_168984|Ga0466714_168984_7438_8607
- Length
- 389 aa
- Sequence
- LCGGLLAKFAFRRVKMLVNAQSIHSAFSLRHIKFNSKTHPRTDGKQALKKRNEHQMYEQTVNVERIEELIGLFGSFDSNIRLLEQSLHVTVLSRENEIKIQGEPEDVYKAARVVDGLLSILARGEAITDQNVNYVISLVEEGEEQKLGELAQDVVCVTMKGKPVKPKTLGQKKYVEAIGKNTVTMGIGPAGTGKTYLAVAAAVTAFRQKRVSRIILTRPAVEAGEKLGFLPGDLQNKVDPYLRPLYDAMFDMLGGENYTKYVERGNIEVAPLAYMRGRTLDDSFIILDEAQNTTREQMKMFLTRLGFNSKVVITGDVTQIDLPGEKVSGLKEAAKVLKNIDDIAICELTARDVVRHALVQRIIRAYEESEAKTETRRARSQTPRRTVKK
Sample Types
Isolate
20.4%
Metagenome
79.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
40.4%
Termitidae
27.7%
Blattidae
10.6%
Kalotermitidae
10.6%
Passalidae
3.2%
Termopsidae
3.2%
Rhinotermitidae
2.1%
Hodotermitidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
220
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 2 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 3 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 4 | 2820348946 | Unclassified Firmicutes Nt197P3bin47 | Isolate | Unclassified |
| 5 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 6 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 7 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 8 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 18 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 19 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 20 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 21 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 22 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 23 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 26 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 27 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 32 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 33 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 34 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 35 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 36 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 44 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 45 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 46 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 47 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 52 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 58 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 59 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 60 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 61 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 62 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 63 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 64 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 65 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 66 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 67 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 68 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 69 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 70 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 71 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 72 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 73 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 74 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 75 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 76 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 77 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 78 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 79 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 80 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 81 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 82 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 83 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 84 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 85 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 86 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 87 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 88 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 89 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 90 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 91 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 92 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 93 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 94 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 95 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_026178 | 3300042599 | Bacteria | 45915 |
| 2 | Ga0466706_028657 | 3300042599 | Bacteria | 4662 |
| 3 | Ga0466706_085224 | 3300042599 | Bacteria | 5645 |
| 4 | Ga0466706_087317 | 3300042599 | Bacteria | 35951 |
| 5 | Ga0466706_187369 | 3300042599 | Bacteria | 2620 |
| 6 | Ga0466706_190264 | 3300042599 | Bacteria | 2142 |
| 7 | Ga0466706_196680 | 3300042599 | Bacteria | 32690 |
| 8 | Ga0466700_265566 | 3300042600 | Bacteria | 4345 |
| 9 | Ga0466707_235877 | 3300042601 | Bacteria | 97126 |
| 10 | Ga0466714_168984 | 3300042603 | Bacteria | 23163 |
| 11 | Ga0466721_084511 | 3300042608 | Bacteria | 6143 |
| 12 | Ga0123356_10137981 | 3300010049 | Bacteria | 2401 |
| 13 | Ga0123353_10047287 | 3300010167 | Bacteria | 6842 |
| 14 | Ga0123354_10189670 | 3300010882 | Unclassified | 2308 |
| 15 | JGI24702J35022_10005121 | 3300002462 | Bacteria | 7695 |
| 16 | JGI24696J40584_12960164 | 3300002834 | Bacteria | 6469 |
| 17 | Ga0072940_1108381 | 3300005200 | Bacteria | 1496 |
| 18 | Ga0072940_1187257 | 3300005200 | Bacteria | 2848 |
| 19 | Ga0072941_1003028 | 3300005201 | Bacteria | 22920 |
| 20 | Ga0415639_039731 | 3300038395 | Bacteria | 4440 |
| 21 | Ga0466733_173970 | 3300042659 | Bacteria | 1558 |
| 22 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 23 | Ga0466728_344635 | 3300042620 | Bacteria | 1602 |
| 24 | Ga0466704_129405 | 3300042643 | Bacteria | 91306 |
| 25 | Ga0466727_169541 | 3300042655 | Bacteria | 5468 |
| 26 | Ga0466706_040979 | 3300042599 | Bacteria | 7880 |
| 27 | Ga0466706_067265 | 3300042599 | Bacteria | 1341 |
| 28 | Ga0466706_095201 | 3300042599 | Bacteria | 118154 |
| 29 | Ga0466706_123322 | 3300042599 | Bacteria | 16565 |
| 30 | Ga0466706_195314 | 3300042599 | Bacteria | 44668 |
| 31 | Ga0466700_029816 | 3300042600 | Bacteria | 1250 |
| 32 | Ga0466714_014410 | 3300042603 | Bacteria | 13801 |
| 33 | Ga0466716_028256 | 3300042605 | Bacteria | 2135 |
| 34 | Ga0466721_073464 | 3300042608 | Bacteria | 6282 |
| 35 | Ga0466698_011576 | 3300042610 | Bacteria | 51802 |
| 36 | Ga0123355_10003700 | 3300009826 | Bacteria | 22053 |
| 37 | Ga0123355_10009807 | 3300009826 | Bacteria | 14611 |
| 38 | Ga0123355_10011949 | 3300009826 | Bacteria | 13420 |
| 39 | Ga0123356_10000165 | 3300010049 | Bacteria | 74230 |
| 40 | Ga0123353_10000283 | 3300010167 | Bacteria | 62786 |
| 41 | Ga0123353_10001000 | 3300010167 | Bacteria | 34647 |
| 42 | Ga0123353_10004210 | 3300010167 | Bacteria | 18470 |
| 43 | Ga0123353_10169535 | 3300010167 | Bacteria | 3466 |
| 44 | 2227155808 | 2225789004 | Bacteria | 8449 |
| 45 | IMNBL1DRAFT_c0000107 | 3300000062 | Bacteria | 74044 |
| 46 | IMNBL1DRAFT_c0025085 | 3300000062 | Bacteria | 2293 |
| 47 | Ga0466715_603011 | 3300042616 | Bacteria | 118245 |
| 48 | Ga0466729_100664 | 3300042621 | Bacteria | 22854 |
| 49 | Ga0466697_226197 | 3300042611 | Bacteria | 2002 |
| 50 | Ga0466709_415489 | 3300042648 | Bacteria | 122307 |
| 51 | Ga0466706_011142 | 3300042599 | Bacteria | 1736 |
| 52 | Ga0466706_030986 | 3300042599 | Bacteria | 13981 |
| 53 | Ga0466706_067020 | 3300042599 | Bacteria | 31831 |
| 54 | Ga0466700_145192 | 3300042600 | Bacteria | 27380 |
| 55 | Ga0123355_10307960 | 3300009826 | Bacteria | 2151 |
| 56 | Ga0123356_10861158 | 3300010049 | Bacteria | 1077 |
| 57 | Ga0123353_10071179 | 3300010167 | Bacteria | 5588 |
| 58 | JGI24700J35501_10930319 | 3300002508 | Bacteria | 12997 |
| 59 | Ga0072940_1070340 | 3300005200 | Bacteria | 14890 |
| 60 | Ga0415639_002079 | 3300038395 | Bacteria | 99204 |
| 61 | Ga0415639_003092 | 3300038395 | Bacteria | 75175 |
| 62 | Ga0415639_047192 | 3300038395 | Bacteria | 2573 |
| 63 | Ga0466693_435719 | 3300042592 | Bacteria | 2580 |
| 64 | Ga0466733_006978 | 3300042659 | Bacteria | 3059 |
| 65 | Ga0466726_005433 | 3300042619 | Bacteria | 2365 |
| 66 | Ga0466729_207923 | 3300042621 | Bacteria | 12727 |
| 67 | Ga0466704_382254 | 3300042643 | Bacteria | 1416 |
| 68 | Ga0466725_315555 | 3300042654 | Bacteria | 8984 |
| 69 | Ga0466706_001194 | 3300042599 | Bacteria | 2158 |
| 70 | Ga0466706_001852 | 3300042599 | Bacteria | 16728 |
| 71 | Ga0466706_023194 | 3300042599 | Bacteria | 6819 |
| 72 | Ga0466706_025205 | 3300042599 | Bacteria | 18209 |
| 73 | Ga0466706_246617 | 3300042599 | Bacteria | 30903 |
| 74 | Ga0466713_075698 | 3300042602 | Unclassified | 3667 |
| 75 | Ga0466714_029260 | 3300042603 | Bacteria | 40408 |
| 76 | Ga0466719_351372 | 3300042606 | Unclassified | 4662 |
| 77 | Ga0466721_021864 | 3300042608 | Bacteria | 51971 |
| 78 | Ga0466722_080612 | 3300042609 | Bacteria | 64130 |
| 79 | Ga0123355_10008064 | 3300009826 | Bacteria | 15888 |
| 80 | Ga0123355_10280991 | 3300009826 | Bacteria | 2298 |
| 81 | Ga0123356_10000006 | 3300010049 | Bacteria | 247371 |
| 82 | Ga0123356_10006754 | 3300010049 | Bacteria | 11548 |
| 83 | Ga0123356_10301693 | 3300010049 | Bacteria | 1707 |
| 84 | Ga0123356_10462758 | 3300010049 | Bacteria | 1418 |
| 85 | Ga0123353_10095844 | 3300010167 | Bacteria | 4781 |
| 86 | Ga0415639_008088 | 3300038395 | Bacteria | 7822 |
| 87 | Ga0415639_026356 | 3300038395 | Bacteria | 9602 |
| 88 | Ga0415639_027020 | 3300038395 | Bacteria | 34795 |
| 89 | Ga0415639_027668 | 3300038395 | Bacteria | 14268 |
| 90 | Ga0466729_106495 | 3300042621 | Bacteria | 4759 |
| 91 | Ga0466735_137647 | 3300042624 | Bacteria | 3350 |
| 92 | Ga0466706_027089 | 3300042599 | Unclassified | 20561 |
| 93 | Ga0466706_029249 | 3300042599 | Bacteria | 34167 |
| 94 | Ga0466706_048314 | 3300042599 | Bacteria | 19481 |
| 95 | Ga0466706_064826 | 3300042599 | Unclassified | 13439 |
| 96 | Ga0466706_086804 | 3300042599 | Bacteria | 1388 |
| 97 | Ga0466700_114422 | 3300042600 | Bacteria | 1891 |
| 98 | Ga0123355_10498360 | 3300009826 | Bacteria | 1504 |
| 99 | Ga0123356_10030615 | 3300010049 | Bacteria | 5037 |
| 100 | Ga0123353_10019906 | 3300010167 | Bacteria | 9996 |
| 101 | IMNBL1DRAFT_c0000006 | 3300000062 | Bacteria | 247403 |
| 102 | AustNasuHG_c1002721 | 3300000089 | Bacteria | 6375 |
| 103 | Ga0068305_10002017 | 3300005083 | Bacteria | 102589 |
| 104 | Ga0072940_1118215 | 3300005200 | Bacteria | 6925 |
| 105 | Ga0123357_10000374 | 3300009784 | Bacteria | 42320 |
| 106 | Ga0415639_026337 | 3300038395 | Bacteria | 3477 |
| 107 | Ga0466696_290719 | 3300042596 | Bacteria | 3015 |
| 108 | Ga0466711_303817 | 3300042615 | Bacteria | 10891 |
| 109 | Ga0466715_064381 | 3300042616 | Bacteria | 17039 |
| 110 | Ga0466705_126006 | 3300042612 | Bacteria | 17837 |
| 111 | Ga0466734_145111 | 3300042623 | Bacteria | 1188 |
| 112 | Ga0466703_326589 | 3300042636 | Bacteria | 2380 |
| 113 | Ga0466703_394017 | 3300042636 | Bacteria | 6497 |
| 114 | Ga0466725_353996 | 3300042654 | Bacteria | 9003 |
| 115 | Ga0466706_053875 | 3300042599 | Unclassified | 1181 |
| 116 | Ga0466706_234100 | 3300042599 | Bacteria | 2765 |
| 117 | Ga0466698_060115 | 3300042610 | Bacteria | 4773 |
| 118 | Ga0123355_10001884 | 3300009826 | Bacteria | 29427 |
| 119 | Ga0123355_10029618 | 3300009826 | Bacteria | 8867 |
| 120 | Ga0123353_10003912 | 3300010167 | Bacteria | 19029 |
| 121 | Ga0123353_10009989 | 3300010167 | Bacteria | 13178 |
| 122 | Ga0123353_10048455 | 3300010167 | Bacteria | 6765 |
| 123 | Ga0123353_10240060 | 3300010167 | Bacteria | 2816 |
| 124 | Ga0072941_1419668 | 3300005201 | Bacteria | 1266 |
| 125 | Ga0415639_003959 | 3300038395 | Bacteria | 20854 |
| 126 | Ga0415639_014858 | 3300038395 | Bacteria | 3742 |
| 127 | Ga0466693_050672 | 3300042592 | Bacteria | 1279 |
| 128 | Ga0466711_322714 | 3300042615 | Bacteria | 10997 |
| 129 | Ga0466726_136262 | 3300042619 | Bacteria | 4451 |
| 130 | Ga0466703_140310 | 3300042636 | Bacteria | 83054 |
| 131 | Ga0466727_084942 | 3300042655 | Bacteria | 25982 |
| 132 | Ga0466706_084229 | 3300042599 | Bacteria | 22953 |
| 133 | Ga0466706_141377 | 3300042599 | Bacteria | 33052 |
| 134 | Ga0466706_155529 | 3300042599 | Unclassified | 5746 |
| 135 | Ga0466706_236837 | 3300042599 | Bacteria | 2602 |
| 136 | Ga0466706_287663 | 3300042599 | Bacteria | 14767 |
| 137 | Ga0466700_192658 | 3300042600 | Unclassified | 2478 |
| 138 | Ga0466700_406004 | 3300042600 | Bacteria | 1543 |
| 139 | Ga0466713_093269 | 3300042602 | Bacteria | 37645 |
| 140 | Ga0123353_10001217 | 3300010167 | Bacteria | 31509 |
| 141 | Ga0123353_10005811 | 3300010167 | Bacteria | 16298 |
| 142 | Ga0123353_10028378 | 3300010167 | Bacteria | 8598 |
| 143 | Ga0123353_10124002 | 3300010167 | Bacteria | 4153 |
| 144 | Ga0123353_10221044 | 3300010167 | Bacteria | 2961 |
| 145 | Ga0123353_10264394 | 3300010167 | Unclassified | 2655 |
| 146 | Ga0123353_10270869 | 3300010167 | Bacteria | 2616 |
| 147 | Ga0123353_10351237 | 3300010167 | Bacteria | 2222 |
| 148 | 2227068296 | 2225789003 | Bacteria | 2990 |
| 149 | IMNBL1DRAFT_c0000073 | 3300000062 | Bacteria | 90912 |
| 150 | IMNBL1DRAFT_c0005604 | 3300000062 | Bacteria | 7124 |
| 151 | IMNBL1DRAFT_c0028194 | 3300000062 | Bacteria | 2099 |
| 152 | Ga0072941_1043335 | 3300005201 | Bacteria | 12558 |
| 153 | Ga0415639_027021 | 3300038395 | Bacteria | 10780 |
| 154 | Ga0415639_105112 | 3300038395 | Bacteria | 7186 |
| 155 | Ga0466733_076389 | 3300042659 | Bacteria | 5613 |
| 156 | Ga0466733_121520 | 3300042659 | Bacteria | 1591 |
| 157 | Ga0466726_390783 | 3300042619 | Bacteria | 4514 |
| 158 | Ga0466702_319245 | 3300042635 | Bacteria | 115897 |
| 159 | Ga0466703_291427 | 3300042636 | Bacteria | 1821 |
| 160 | Ga0466704_189699 | 3300042643 | Bacteria | 1974 |
| 161 | Ga0466704_260273 | 3300042643 | Bacteria | 6162 |
| 162 | Ga0466724_57033 | 3300042649 | Bacteria | 7011 |
| 163 | Ga0466725_407340 | 3300042654 | Bacteria | 15312 |
| 164 | Ga0466701_083582 | 3300042598 | Bacteria | 5261 |
| 165 | Ga0466706_041195 | 3300042599 | Bacteria | 11167 |
| 166 | Ga0466706_072051 | 3300042599 | Unclassified | 8604 |
| 167 | Ga0466706_168088 | 3300042599 | Bacteria | 6006 |
| 168 | Ga0123355_10204925 | 3300009826 | Bacteria | 2872 |
| 169 | Ga0123356_10001077 | 3300010049 | Bacteria | 30256 |
| 170 | Ga0123353_10006774 | 3300010167 | Bacteria | 15353 |
| 171 | Ga0123353_10023382 | 3300010167 | Bacteria | 9355 |
| 172 | Ga0123353_10048741 | 3300010167 | Bacteria | 6746 |
| 173 | Ga0123353_10133471 | 3300010167 | Bacteria | 3983 |
| 174 | Ga0123353_10700211 | 3300010167 | Bacteria | 1422 |
| 175 | Ga0466696_013633 | 3300042596 | Bacteria | 9185 |
| 176 | Ga0466696_115603 | 3300042596 | Bacteria | 21537 |
| 177 | Ga0466696_476755 | 3300042596 | Bacteria | 3929 |
| 178 | Ga0466733_205386 | 3300042659 | Bacteria | 2468 |
| 179 | Ga0466715_267186 | 3300042616 | Bacteria | 3188 |
| 180 | Ga0466718_037165 | 3300042617 | Bacteria | 3680 |
| 181 | Ga0466697_192603 | 3300042611 | Bacteria | 1987 |
| 182 | Ga0466705_036513 | 3300042612 | Bacteria | 122886 |
| 183 | Ga0466724_34543 | 3300042649 | Bacteria | 6354 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02562 | GO:0005524 | ATP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.