Protein Family IF06241

Metagenome Isolate
230 Members
95 Samples
183 Scaffolds
329.51 Avg Length

🧬 Representative Sequence

ID
3300042603|Ga0466714_168984|Ga0466714_168984_7438_8607
Length
389 aa
Sequence
LCGGLLAKFAFRRVKMLVNAQSIHSAFSLRHIKFNSKTHPRTDGKQALKKRNEHQMYEQTVNVERIEELIGLFGSFDSNIRLLEQSLHVTVLSRENEIKIQGEPEDVYKAARVVDGLLSILARGEAITDQNVNYVISLVEEGEEQKLGELAQDVVCVTMKGKPVKPKTLGQKKYVEAIGKNTVTMGIGPAGTGKTYLAVAAAVTAFRQKRVSRIILTRPAVEAGEKLGFLPGDLQNKVDPYLRPLYDAMFDMLGGENYTKYVERGNIEVAPLAYMRGRTLDDSFIILDEAQNTTREQMKMFLTRLGFNSKVVITGDVTQIDLPGEKVSGLKEAAKVLKNIDDIAICELTARDVVRHALVQRIIRAYEESEAKTETRRARSQTPRRTVKK

πŸ“Š Sample Types

Isolate 20.4%
Metagenome 79.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 40.4%
Termitidae 27.7%
Blattidae 10.6%
Kalotermitidae 10.6%
Passalidae 3.2%
Termopsidae 3.2%
Rhinotermitidae 2.1%
Hodotermitidae 1.1%
Tenebrionidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 220
Eukaryota 0
Viruses 0
Unclassified 10

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
2 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
3 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
4 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
5 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
6 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
7 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
8 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
19 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
20 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
21 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
22 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
23 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
26 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
27 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
32 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
33 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
34 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
35 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
36 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
37 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
42 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
43 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
44 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
45 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
46 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
47 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
48 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
49 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
50 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
51 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
52 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
53 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
54 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
55 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
56 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
57 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
58 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
59 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
60 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
61 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
62 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
63 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
64 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
65 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
66 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
67 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
68 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
69 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
70 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
71 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
72 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
73 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
74 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
75 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
76 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
77 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
78 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
79 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
80 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
81 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
82 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
83 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
84 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
85 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
86 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
87 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
88 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
89 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
90 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
91 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
92 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
93 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
94 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
95 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_026178 3300042599 Bacteria 45915
2 Ga0466706_028657 3300042599 Bacteria 4662
3 Ga0466706_085224 3300042599 Bacteria 5645
4 Ga0466706_087317 3300042599 Bacteria 35951
5 Ga0466706_187369 3300042599 Bacteria 2620
6 Ga0466706_190264 3300042599 Bacteria 2142
7 Ga0466706_196680 3300042599 Bacteria 32690
8 Ga0466700_265566 3300042600 Bacteria 4345
9 Ga0466707_235877 3300042601 Bacteria 97126
10 Ga0466714_168984 3300042603 Bacteria 23163
11 Ga0466721_084511 3300042608 Bacteria 6143
12 Ga0123356_10137981 3300010049 Bacteria 2401
13 Ga0123353_10047287 3300010167 Bacteria 6842
14 Ga0123354_10189670 3300010882 Unclassified 2308
15 JGI24702J35022_10005121 3300002462 Bacteria 7695
16 JGI24696J40584_12960164 3300002834 Bacteria 6469
17 Ga0072940_1108381 3300005200 Bacteria 1496
18 Ga0072940_1187257 3300005200 Bacteria 2848
19 Ga0072941_1003028 3300005201 Bacteria 22920
20 Ga0415639_039731 3300038395 Bacteria 4440
21 Ga0466733_173970 3300042659 Bacteria 1558
22 Ga0562377_0006 3300056842 Bacteria 3350072
23 Ga0466728_344635 3300042620 Bacteria 1602
24 Ga0466704_129405 3300042643 Bacteria 91306
25 Ga0466727_169541 3300042655 Bacteria 5468
26 Ga0466706_040979 3300042599 Bacteria 7880
27 Ga0466706_067265 3300042599 Bacteria 1341
28 Ga0466706_095201 3300042599 Bacteria 118154
29 Ga0466706_123322 3300042599 Bacteria 16565
30 Ga0466706_195314 3300042599 Bacteria 44668
31 Ga0466700_029816 3300042600 Bacteria 1250
32 Ga0466714_014410 3300042603 Bacteria 13801
33 Ga0466716_028256 3300042605 Bacteria 2135
34 Ga0466721_073464 3300042608 Bacteria 6282
35 Ga0466698_011576 3300042610 Bacteria 51802
36 Ga0123355_10003700 3300009826 Bacteria 22053
37 Ga0123355_10009807 3300009826 Bacteria 14611
38 Ga0123355_10011949 3300009826 Bacteria 13420
39 Ga0123356_10000165 3300010049 Bacteria 74230
40 Ga0123353_10000283 3300010167 Bacteria 62786
41 Ga0123353_10001000 3300010167 Bacteria 34647
42 Ga0123353_10004210 3300010167 Bacteria 18470
43 Ga0123353_10169535 3300010167 Bacteria 3466
44 2227155808 2225789004 Bacteria 8449
45 IMNBL1DRAFT_c0000107 3300000062 Bacteria 74044
46 IMNBL1DRAFT_c0025085 3300000062 Bacteria 2293
47 Ga0466715_603011 3300042616 Bacteria 118245
48 Ga0466729_100664 3300042621 Bacteria 22854
49 Ga0466697_226197 3300042611 Bacteria 2002
50 Ga0466709_415489 3300042648 Bacteria 122307
51 Ga0466706_011142 3300042599 Bacteria 1736
52 Ga0466706_030986 3300042599 Bacteria 13981
53 Ga0466706_067020 3300042599 Bacteria 31831
54 Ga0466700_145192 3300042600 Bacteria 27380
55 Ga0123355_10307960 3300009826 Bacteria 2151
56 Ga0123356_10861158 3300010049 Bacteria 1077
57 Ga0123353_10071179 3300010167 Bacteria 5588
58 JGI24700J35501_10930319 3300002508 Bacteria 12997
59 Ga0072940_1070340 3300005200 Bacteria 14890
60 Ga0415639_002079 3300038395 Bacteria 99204
61 Ga0415639_003092 3300038395 Bacteria 75175
62 Ga0415639_047192 3300038395 Bacteria 2573
63 Ga0466693_435719 3300042592 Bacteria 2580
64 Ga0466733_006978 3300042659 Bacteria 3059
65 Ga0466726_005433 3300042619 Bacteria 2365
66 Ga0466729_207923 3300042621 Bacteria 12727
67 Ga0466704_382254 3300042643 Bacteria 1416
68 Ga0466725_315555 3300042654 Bacteria 8984
69 Ga0466706_001194 3300042599 Bacteria 2158
70 Ga0466706_001852 3300042599 Bacteria 16728
71 Ga0466706_023194 3300042599 Bacteria 6819
72 Ga0466706_025205 3300042599 Bacteria 18209
73 Ga0466706_246617 3300042599 Bacteria 30903
74 Ga0466713_075698 3300042602 Unclassified 3667
75 Ga0466714_029260 3300042603 Bacteria 40408
76 Ga0466719_351372 3300042606 Unclassified 4662
77 Ga0466721_021864 3300042608 Bacteria 51971
78 Ga0466722_080612 3300042609 Bacteria 64130
79 Ga0123355_10008064 3300009826 Bacteria 15888
80 Ga0123355_10280991 3300009826 Bacteria 2298
81 Ga0123356_10000006 3300010049 Bacteria 247371
82 Ga0123356_10006754 3300010049 Bacteria 11548
83 Ga0123356_10301693 3300010049 Bacteria 1707
84 Ga0123356_10462758 3300010049 Bacteria 1418
85 Ga0123353_10095844 3300010167 Bacteria 4781
86 Ga0415639_008088 3300038395 Bacteria 7822
87 Ga0415639_026356 3300038395 Bacteria 9602
88 Ga0415639_027020 3300038395 Bacteria 34795
89 Ga0415639_027668 3300038395 Bacteria 14268
90 Ga0466729_106495 3300042621 Bacteria 4759
91 Ga0466735_137647 3300042624 Bacteria 3350
92 Ga0466706_027089 3300042599 Unclassified 20561
93 Ga0466706_029249 3300042599 Bacteria 34167
94 Ga0466706_048314 3300042599 Bacteria 19481
95 Ga0466706_064826 3300042599 Unclassified 13439
96 Ga0466706_086804 3300042599 Bacteria 1388
97 Ga0466700_114422 3300042600 Bacteria 1891
98 Ga0123355_10498360 3300009826 Bacteria 1504
99 Ga0123356_10030615 3300010049 Bacteria 5037
100 Ga0123353_10019906 3300010167 Bacteria 9996
101 IMNBL1DRAFT_c0000006 3300000062 Bacteria 247403
102 AustNasuHG_c1002721 3300000089 Bacteria 6375
103 Ga0068305_10002017 3300005083 Bacteria 102589
104 Ga0072940_1118215 3300005200 Bacteria 6925
105 Ga0123357_10000374 3300009784 Bacteria 42320
106 Ga0415639_026337 3300038395 Bacteria 3477
107 Ga0466696_290719 3300042596 Bacteria 3015
108 Ga0466711_303817 3300042615 Bacteria 10891
109 Ga0466715_064381 3300042616 Bacteria 17039
110 Ga0466705_126006 3300042612 Bacteria 17837
111 Ga0466734_145111 3300042623 Bacteria 1188
112 Ga0466703_326589 3300042636 Bacteria 2380
113 Ga0466703_394017 3300042636 Bacteria 6497
114 Ga0466725_353996 3300042654 Bacteria 9003
115 Ga0466706_053875 3300042599 Unclassified 1181
116 Ga0466706_234100 3300042599 Bacteria 2765
117 Ga0466698_060115 3300042610 Bacteria 4773
118 Ga0123355_10001884 3300009826 Bacteria 29427
119 Ga0123355_10029618 3300009826 Bacteria 8867
120 Ga0123353_10003912 3300010167 Bacteria 19029
121 Ga0123353_10009989 3300010167 Bacteria 13178
122 Ga0123353_10048455 3300010167 Bacteria 6765
123 Ga0123353_10240060 3300010167 Bacteria 2816
124 Ga0072941_1419668 3300005201 Bacteria 1266
125 Ga0415639_003959 3300038395 Bacteria 20854
126 Ga0415639_014858 3300038395 Bacteria 3742
127 Ga0466693_050672 3300042592 Bacteria 1279
128 Ga0466711_322714 3300042615 Bacteria 10997
129 Ga0466726_136262 3300042619 Bacteria 4451
130 Ga0466703_140310 3300042636 Bacteria 83054
131 Ga0466727_084942 3300042655 Bacteria 25982
132 Ga0466706_084229 3300042599 Bacteria 22953
133 Ga0466706_141377 3300042599 Bacteria 33052
134 Ga0466706_155529 3300042599 Unclassified 5746
135 Ga0466706_236837 3300042599 Bacteria 2602
136 Ga0466706_287663 3300042599 Bacteria 14767
137 Ga0466700_192658 3300042600 Unclassified 2478
138 Ga0466700_406004 3300042600 Bacteria 1543
139 Ga0466713_093269 3300042602 Bacteria 37645
140 Ga0123353_10001217 3300010167 Bacteria 31509
141 Ga0123353_10005811 3300010167 Bacteria 16298
142 Ga0123353_10028378 3300010167 Bacteria 8598
143 Ga0123353_10124002 3300010167 Bacteria 4153
144 Ga0123353_10221044 3300010167 Bacteria 2961
145 Ga0123353_10264394 3300010167 Unclassified 2655
146 Ga0123353_10270869 3300010167 Bacteria 2616
147 Ga0123353_10351237 3300010167 Bacteria 2222
148 2227068296 2225789003 Bacteria 2990
149 IMNBL1DRAFT_c0000073 3300000062 Bacteria 90912
150 IMNBL1DRAFT_c0005604 3300000062 Bacteria 7124
151 IMNBL1DRAFT_c0028194 3300000062 Bacteria 2099
152 Ga0072941_1043335 3300005201 Bacteria 12558
153 Ga0415639_027021 3300038395 Bacteria 10780
154 Ga0415639_105112 3300038395 Bacteria 7186
155 Ga0466733_076389 3300042659 Bacteria 5613
156 Ga0466733_121520 3300042659 Bacteria 1591
157 Ga0466726_390783 3300042619 Bacteria 4514
158 Ga0466702_319245 3300042635 Bacteria 115897
159 Ga0466703_291427 3300042636 Bacteria 1821
160 Ga0466704_189699 3300042643 Bacteria 1974
161 Ga0466704_260273 3300042643 Bacteria 6162
162 Ga0466724_57033 3300042649 Bacteria 7011
163 Ga0466725_407340 3300042654 Bacteria 15312
164 Ga0466701_083582 3300042598 Bacteria 5261
165 Ga0466706_041195 3300042599 Bacteria 11167
166 Ga0466706_072051 3300042599 Unclassified 8604
167 Ga0466706_168088 3300042599 Bacteria 6006
168 Ga0123355_10204925 3300009826 Bacteria 2872
169 Ga0123356_10001077 3300010049 Bacteria 30256
170 Ga0123353_10006774 3300010167 Bacteria 15353
171 Ga0123353_10023382 3300010167 Bacteria 9355
172 Ga0123353_10048741 3300010167 Bacteria 6746
173 Ga0123353_10133471 3300010167 Bacteria 3983
174 Ga0123353_10700211 3300010167 Bacteria 1422
175 Ga0466696_013633 3300042596 Bacteria 9185
176 Ga0466696_115603 3300042596 Bacteria 21537
177 Ga0466696_476755 3300042596 Bacteria 3929
178 Ga0466733_205386 3300042659 Bacteria 2468
179 Ga0466715_267186 3300042616 Bacteria 3188
180 Ga0466718_037165 3300042617 Bacteria 3680
181 Ga0466697_192603 3300042611 Bacteria 1987
182 Ga0466705_036513 3300042612 Bacteria 122886
183 Ga0466724_34543 3300042649 Bacteria 6354

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02562 PhoH PhoH-like protein 164 367 0.99
PF13245 AAA_19 AAA domain 171 320 0.78
PF13604 AAA_30 AAA domain 170 320 0.78

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02562 GO:0005524 ATP binding MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.