Protein Family IF06107
Metagenome
Isolate
189
Members
73
Samples
170
Scaffolds
403.07
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_097948|Ga0466713_097948_31476_32885
- Length
- 469 aa
- Sequence
- MVTACATAAAGTSDADAGNAKSSRMIHPLDAQKNPCYSEPPTAFSPRSHSRGFLNVSVKGGLMQEIVGKYNTAKVFTDKCDDFSLQQVKTLCDQAFTAGSKIRLMPDVHAGAGCTIGTTMTISDKVVPNMVGVDIGCGMETLVVPAESEFAAGFDPAKLDALVRERIPCGREVRDTPHPLIEQAGLDAIRCPAIQKGRARKSLGTLGGGNHFIEADRDEDGNLYLVVHSGSRHLGLEVAGYYQEEAWAQLNHSRSQDINAMIAELKAAGRTKEIPGEIRRVRSQARTNIPKSLAYVSGDLFNDYLHDMKLVQRFALLNRKAMMRVILDGLSMPVDGRLEQWTTIHNYIDTEEMILRKGAVSAKAGEKLLIPINMRDGSLVCRGLGNPDWNCSAPHGAGRVMSRQKAFKELSLEEYQASMQGIYSTSVGRDTLDESPMAYKTMDDIASNIGPTAEVLRVIKPVYNFKAAE
Sample Types
Isolate
9.5%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.4%
Unclassified
26.8%
Kalotermitidae
19.7%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Blattidae
2.8%
Hodotermitidae
1.4%
Passalidae
1.4%
Taxonomy
Archaea
2
Bacteria
170
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 2 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 13 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 14 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 26 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 27 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 28 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 29 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 35 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 36 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 40 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 41 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 42 | 2820651690 | Unclassified Firmicutes Cu122P3bin6 | Isolate | Unclassified |
| 43 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 44 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 45 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 46 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 47 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 48 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 49 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 50 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 51 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 52 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 53 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 54 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 55 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 57 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 58 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 61 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 66 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 67 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 68 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 69 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 70 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 71 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 72 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 73 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | IMNBL1DRAFT_c0008850 | 3300000062 | Bacteria | 5069 |
| 2 | AustNasuHG_c1003260 | 3300000089 | Bacteria | 5864 |
| 3 | AustNasuHG_c1024616 | 3300000089 | Bacteria | 1903 |
| 4 | Ga0072941_1002463 | 3300005201 | Bacteria | 31699 |
| 5 | Ga0264413_135637 | 3300024493 | Bacteria | 8818 |
| 6 | Ga0466690_123716 | 3300042590 | Bacteria | 7906 |
| 7 | Ga0466696_254953 | 3300042596 | Bacteria | 27601 |
| 8 | Ga0466711_192757 | 3300042615 | Bacteria | 36180 |
| 9 | Ga0466718_087275 | 3300042617 | Bacteria | 5991 |
| 10 | Ga0466723_091731 | 3300042618 | Bacteria | 2031 |
| 11 | Ga0466726_401296 | 3300042619 | Bacteria | 2977 |
| 12 | Ga0466726_431332 | 3300042619 | Bacteria | 2979 |
| 13 | Ga0123357_10055311 | 3300009784 | Bacteria | 5343 |
| 14 | Ga0123356_10002367 | 3300010049 | Bacteria | 20223 |
| 15 | Ga0123356_10009080 | 3300010049 | Bacteria | 9831 |
| 16 | Ga0123356_10180964 | 3300010049 | Bacteria | 2129 |
| 17 | Ga0123356_10192129 | 3300010049 | Bacteria | 2074 |
| 18 | Ga0123354_10144616 | 3300010882 | Bacteria | 2919 |
| 19 | Ga0466731_329673 | 3300042622 | Bacteria | 3098 |
| 20 | Ga0466704_149896 | 3300042643 | Bacteria | 8911 |
| 21 | Ga0466725_132819 | 3300042654 | Bacteria | 26980 |
| 22 | Ga0466706_166198 | 3300042599 | Bacteria | 39918 |
| 23 | Ga0466707_378263 | 3300042601 | Bacteria | 16475 |
| 24 | Ga0466722_063808 | 3300042609 | Bacteria | 7500 |
| 25 | Ga0466722_100947 | 3300042609 | Bacteria | 16833 |
| 26 | AustNasuHG_c1002254 | 3300000089 | Bacteria | 6956 |
| 27 | JGI24698J34947_10000990 | 3300002449 | Bacteria | 14566 |
| 28 | JGI24695J34938_10000217 | 3300002450 | Bacteria | 55213 |
| 29 | JGI24695J34938_10003047 | 3300002450 | Bacteria | 12017 |
| 30 | JGI24695J34938_10021166 | 3300002450 | Bacteria | 3185 |
| 31 | JGI24702J35022_10015641 | 3300002462 | Bacteria | 4169 |
| 32 | JGI24697J35500_11186038 | 3300002507 | Bacteria | 1551 |
| 33 | JGI24700J35501_10928786 | 3300002508 | Bacteria | 8081 |
| 34 | Ga0072941_1000579 | 3300005201 | Bacteria | 109731 |
| 35 | Ga0415639_009901 | 3300038395 | Bacteria | 3030 |
| 36 | Ga0415639_017152 | 3300038395 | Bacteria | 18110 |
| 37 | Ga0466693_079624 | 3300042592 | Bacteria | 1628 |
| 38 | Ga0466699_225053 | 3300042597 | Bacteria | 3491 |
| 39 | Ga0466715_213993 | 3300042616 | Bacteria | 2340 |
| 40 | Ga0466718_078640 | 3300042617 | Bacteria | 14183 |
| 41 | Ga0466726_067803 | 3300042619 | Bacteria | 8139 |
| 42 | Ga0466726_097352 | 3300042619 | Bacteria | 7396 |
| 43 | Ga0123356_10039645 | 3300010049 | Bacteria | 4388 |
| 44 | Ga0466731_145473 | 3300042622 | Bacteria | 2519 |
| 45 | Ga0466709_187107 | 3300042648 | Bacteria | 3039 |
| 46 | Ga0466708_127844 | 3300042652 | Bacteria | 9577 |
| 47 | Ga0466708_399536 | 3300042652 | Bacteria | 3091 |
| 48 | Ga0466720_151977 | 3300042607 | Bacteria | 30631 |
| 49 | Ga0466721_081636 | 3300042608 | Bacteria | 4384 |
| 50 | JGI24698J34947_10002023 | 3300002449 | Bacteria | 10810 |
| 51 | JGI24695J34938_10049248 | 3300002450 | Bacteria | 1852 |
| 52 | Ga0068305_10063519 | 3300005083 | Bacteria | 6141 |
| 53 | Ga0466690_060536 | 3300042590 | Bacteria | 2288 |
| 54 | Ga0466696_246029 | 3300042596 | Bacteria | 1716 |
| 55 | Ga0466699_074311 | 3300042597 | Bacteria | 20737 |
| 56 | Ga0466712_072099 | 3300042614 | Unclassified | 3101 |
| 57 | Ga0466712_077165 | 3300042614 | Bacteria | 14267 |
| 58 | Ga0466712_185644 | 3300042614 | Bacteria | 11163 |
| 59 | Ga0466718_071750 | 3300042617 | Bacteria | 1847 |
| 60 | Ga0466723_116209 | 3300042618 | Bacteria | 2113 |
| 61 | Ga0466729_097884 | 3300042621 | Bacteria | 1939 |
| 62 | Ga0123356_10002265 | 3300010049 | Bacteria | 20756 |
| 63 | Ga0123356_10004233 | 3300010049 | Unclassified | 14843 |
| 64 | Ga0123356_10004392 | 3300010049 | Bacteria | 14570 |
| 65 | Ga0123353_10378712 | 3300010167 | Bacteria | 2118 |
| 66 | Ga0466731_359346 | 3300042622 | Bacteria | 4401 |
| 67 | Ga0466703_133030 | 3300042636 | Unclassified | 2019 |
| 68 | Ga0466727_266933 | 3300042655 | Unclassified | 3278 |
| 69 | Ga0466706_159313 | 3300042599 | Bacteria | 2826 |
| 70 | Ga0466707_155509 | 3300042601 | Bacteria | 1319 |
| 71 | Ga0466714_111583 | 3300042603 | Bacteria | 2243 |
| 72 | Ga0466717_074038 | 3300042604 | Bacteria | 2175 |
| 73 | Ga0466716_285211 | 3300042605 | Unclassified | 3279 |
| 74 | Ga0466732_066115 | 3300042656 | Bacteria | 6890 |
| 75 | JGI24695J34938_10000724 | 3300002450 | Bacteria | 31069 |
| 76 | JGI24702J35022_10010796 | 3300002462 | Archaea | 5096 |
| 77 | JGI24702J35022_10036629 | 3300002462 | Bacteria | 2622 |
| 78 | JGI24705J35276_12214555 | 3300002504 | Bacteria | 1966 |
| 79 | Ga0072941_1072014 | 3300005201 | Bacteria | 1721 |
| 80 | Ga0072941_1141773 | 3300005201 | Bacteria | 3380 |
| 81 | Ga0415639_011109 | 3300038395 | Bacteria | 33335 |
| 82 | Ga0415639_042255 | 3300038395 | Bacteria | 13028 |
| 83 | Ga0466690_170268 | 3300042590 | Bacteria | 2681 |
| 84 | Ga0466699_122134 | 3300042597 | Bacteria | 18512 |
| 85 | Ga0466699_140424 | 3300042597 | Bacteria | 4468 |
| 86 | Ga0466699_264710 | 3300042597 | Bacteria | 2351 |
| 87 | Ga0466711_458167 | 3300042615 | Bacteria | 21346 |
| 88 | Ga0466718_117611 | 3300042617 | Bacteria | 5074 |
| 89 | Ga0466728_010321 | 3300042620 | Bacteria | 2582 |
| 90 | Ga0123355_10193732 | 3300009826 | Bacteria | 2986 |
| 91 | Ga0123353_10138272 | 3300010167 | Bacteria | 3905 |
| 92 | Ga0466735_091987 | 3300042624 | Bacteria | 2905 |
| 93 | Ga0466703_138482 | 3300042636 | Bacteria | 7710 |
| 94 | Ga0466703_195532 | 3300042636 | Unclassified | 5660 |
| 95 | Ga0466704_522378 | 3300042643 | Unclassified | 5151 |
| 96 | Ga0466719_568263 | 3300042606 | Bacteria | 3881 |
| 97 | Ga0466705_199226 | 3300042612 | Bacteria | 2695 |
| 98 | JGI24698J34947_10000635 | 3300002449 | Bacteria | 16938 |
| 99 | JGI24698J34947_10004732 | 3300002449 | Bacteria | 7432 |
| 100 | JGI24695J34938_10059536 | 3300002450 | Bacteria | 1633 |
| 101 | JGI24702J35022_10001389 | 3300002462 | Bacteria | 15049 |
| 102 | JGI24702J35022_10011673 | 3300002462 | Bacteria | 4898 |
| 103 | JGI24705J35276_12185451 | 3300002504 | Bacteria | 1410 |
| 104 | Ga0415639_102177 | 3300038395 | Bacteria | 1429 |
| 105 | Ga0466690_386234 | 3300042590 | Bacteria | 6160 |
| 106 | Ga0466693_039288 | 3300042592 | Bacteria | 17723 |
| 107 | Ga0466718_026920 | 3300042617 | Unclassified | 2251 |
| 108 | Ga0466718_074084 | 3300042617 | Bacteria | 4007 |
| 109 | Ga0123357_10197160 | 3300009784 | Bacteria | 2302 |
| 110 | Ga0466727_292247 | 3300042655 | Bacteria | 1659 |
| 111 | Ga0466719_263815 | 3300042606 | Bacteria | 1531 |
| 112 | Ga0466719_376233 | 3300042606 | Bacteria | 1701 |
| 113 | Ga0466720_173739 | 3300042607 | Unclassified | 4714 |
| 114 | Ga0466722_217333 | 3300042609 | Bacteria | 2614 |
| 115 | AustNasuHG_c1004628 | 3300000089 | Bacteria | 4936 |
| 116 | AustNasuHG_c1008454 | 3300000089 | Bacteria | 3640 |
| 117 | AustNasuHG_c1012440 | 3300000089 | Bacteria | 2938 |
| 118 | JGI24698J34947_10033172 | 3300002449 | Bacteria | 2709 |
| 119 | JGI24695J34938_10018874 | 3300002450 | Unclassified | 3433 |
| 120 | Ga0264413_133904 | 3300024493 | Bacteria | 2465 |
| 121 | Ga0466692_130610 | 3300042591 | Bacteria | 16865 |
| 122 | Ga0466691_079544 | 3300042593 | Bacteria | 1746 |
| 123 | Ga0466705_416682 | 3300042612 | Bacteria | 13885 |
| 124 | Ga0466723_327100 | 3300042618 | Bacteria | 1724 |
| 125 | Ga0123356_10005273 | 3300010049 | Bacteria | 13195 |
| 126 | Ga0123353_10012196 | 3300010167 | Bacteria | 12192 |
| 127 | Ga0123353_10148252 | 3300010167 | Bacteria | 3749 |
| 128 | Ga0466729_223936 | 3300042621 | Bacteria | 3554 |
| 129 | Ga0466731_339199 | 3300042622 | Bacteria | 43843 |
| 130 | Ga0466703_430151 | 3300042636 | Bacteria | 25228 |
| 131 | Ga0466704_094044 | 3300042643 | Bacteria | 4205 |
| 132 | Ga0466727_232801 | 3300042655 | Bacteria | 2721 |
| 133 | Ga0466700_039672 | 3300042600 | Bacteria | 1898 |
| 134 | Ga0466713_048745 | 3300042602 | Bacteria | 4691 |
| 135 | Ga0466719_314367 | 3300042606 | Bacteria | 1711 |
| 136 | Ga0466719_403544 | 3300042606 | Bacteria | 1742 |
| 137 | Ga0466733_039904 | 3300042659 | Bacteria | 2813 |
| 138 | JGI24698J34947_10003085 | 3300002449 | Bacteria | 9019 |
| 139 | JGI24695J34938_10031733 | 3300002450 | Bacteria | 2447 |
| 140 | Ga0415639_138215 | 3300038395 | Bacteria | 1432 |
| 141 | Ga0466691_218612 | 3300042593 | Bacteria | 7134 |
| 142 | Ga0466696_097197 | 3300042596 | Archaea | 2017 |
| 143 | Ga0466699_034790 | 3300042597 | Bacteria | 4050 |
| 144 | Ga0466712_244462 | 3300042614 | Bacteria | 26322 |
| 145 | Ga0466715_206839 | 3300042616 | Bacteria | 1412 |
| 146 | Ga0466728_087954 | 3300042620 | Bacteria | 6228 |
| 147 | Ga0123356_10391232 | 3300010049 | Unclassified | 1525 |
| 148 | Ga0123353_10129167 | 3300010167 | Bacteria | 4057 |
| 149 | Ga0466731_375477 | 3300042622 | Bacteria | 1639 |
| 150 | Ga0466704_064098 | 3300042643 | Bacteria | 8776 |
| 151 | Ga0466704_065068 | 3300042643 | Bacteria | 4300 |
| 152 | Ga0466704_541316 | 3300042643 | Bacteria | 2575 |
| 153 | Ga0466701_070007 | 3300042598 | Bacteria | 2119 |
| 154 | Ga0466713_097948 | 3300042602 | Bacteria | 33369 |
| 155 | Ga0466717_286165 | 3300042604 | Unclassified | 5015 |
| 156 | Ga0466720_029459 | 3300042607 | Bacteria | 10191 |
| 157 | Ga0466722_006386 | 3300042609 | Bacteria | 5340 |
| 158 | Ga0466698_028159 | 3300042610 | Bacteria | 6821 |
| 159 | Ga0466705_078170 | 3300042612 | Bacteria | 3760 |
| 160 | Ga0466732_436719 | 3300042656 | Bacteria | 2994 |
| 161 | AustNasuHG_c1005965 | 3300000089 | Unclassified | 4358 |
| 162 | JGI24698J34947_10001336 | 3300002449 | Bacteria | 12966 |
| 163 | JGI24702J35022_10043846 | 3300002462 | Unclassified | 2383 |
| 164 | Ga0466712_247538 | 3300042614 | Unclassified | 3144 |
| 165 | Ga0466711_510758 | 3300042615 | Bacteria | 5190 |
| 166 | Ga0466726_305226 | 3300042619 | Bacteria | 2933 |
| 167 | Ga0123354_10000037 | 3300010882 | Bacteria | 97859 |
| 168 | Ga0466703_430565 | 3300042636 | Unclassified | 2253 |
| 169 | Ga0466704_119362 | 3300042643 | Bacteria | 5158 |
| 170 | Ga0466721_225174 | 3300042608 | Bacteria | 32299 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01139 | RtcB | tRNA-splicing ligase RtcB | 194 | 466 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.