Protein Family IF06064

Metagenome Isolate
308 Members
88 Samples
270 Scaffolds
360.71 Avg Length

🧬 Representative Sequence

ID
3300042602|Ga0466713_045976|Ga0466713_045976_13550_14893
Length
447 aa
Sequence
LARQWRQAYCWDFWAKKALHLFVETQIFAMNVCVFFQNSAINNLCAAFFHKKAFFKAILQGFSISTLLFSEKVVPLPSVTRNVLSMTEEIKLLKGNEAIALAAIRYGADGYFGYPITPQSEIMETLMEEMPWTTTGMVVLQAESEVAAINMVYGGAACGKRVMTSSSSPGISLKQEGISFMAGGELPGLIVNVMRGGPGLGTIQPSQSDYFQTVKGGGHGDYKLITLAPASVQEMADHVVLAFDLSFKYRNPAMILTDGVIGQMMEKVILPPQRARRTDDEIRKECPWAALGKPANRPPNIHSSLELDSQRMEQNNLRFQAKYRQIEANETRGEEYRCEDAEYLIVAFGSAARISQKVVDMARAKGMKIGLFRPITLYPFPVRELYSYVGKIKKILCLELNAGQMIEDVKLAVECRIPTIHYGRLGGIIPTPQEVLDKVEKLQTEQQ

πŸ“Š Sample Types

Isolate 12.3%
Metagenome 87.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 38.4%
Termitidae 22.1%
Kalotermitidae 16.3%
Unclassified 8.1%
Termopsidae 4.7%
Rhinotermitidae 4.7%
Passalidae 3.5%
Hodotermitidae 1.2%
Tenebrionidae 1.2%

🌳 Taxonomy

Archaea 1
Bacteria 296
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
3 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
4 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
5 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
6 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2922326829 Bacteroides sp. 224 Isolate Blattidae
16 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
17 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
18 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
23 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
24 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
25 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
26 2923982719 Parabacteroides sp. 52 Isolate Blattidae
27 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
28 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
29 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
34 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
35 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
36 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
39 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
40 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
41 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
42 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
43 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
44 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
45 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
46 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
47 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
48 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
49 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
50 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
51 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
53 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
54 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
55 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
56 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
57 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
58 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
59 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
60 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
61 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
62 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
63 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
64 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
65 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
66 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
67 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
68 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
69 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
70 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
71 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
72 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
73 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
74 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
75 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
76 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
77 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
78 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
79 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
80 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
81 3004672520 Bacteroides sp. 51 Isolate Blattidae
82 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
83 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
84 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
85 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
86 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
87 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
88 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_006953 3300042599 Bacteria 11042
2 Ga0466700_392445 3300042600 Bacteria 26880
3 Ga0466707_151700 3300042601 Bacteria 16468
4 Ga0466713_037701 3300042602 Bacteria 30244
5 Ga0466713_061927 3300042602 Bacteria 3913
6 Ga0466717_156770 3300042604 Bacteria 2511
7 Ga0466722_023479 3300042609 Bacteria 103035
8 Ga0466722_108746 3300042609 Bacteria 15437
9 Ga0466690_027177 3300042590 Bacteria 32769
10 Ga0466692_166187 3300042591 Bacteria 20656
11 Ga0466691_199211 3300042593 Bacteria 19849
12 Ga0466696_488609 3300042596 Bacteria 4358
13 IMNBL1DRAFT_c0000270 3300000062 Bacteria 45954
14 Ga0123357_10146126 3300009784 Unclassified 2887
15 Ga0123354_10118574 3300010882 Bacteria 3435
16 Ga0466705_125056 3300042612 Bacteria 16098
17 Ga0466729_217293 3300042621 Bacteria 5729
18 Ga0466735_105515 3300042624 Bacteria 7803
19 Ga0466735_206696 3300042624 Bacteria 3272
20 Ga0466703_212954 3300042636 Bacteria 10233
21 Ga0466704_176646 3300042643 Bacteria 62821
22 Ga0466704_353772 3300042643 Bacteria 9855
23 Ga0466709_060912 3300042648 Bacteria 22527
24 Ga0466709_186617 3300042648 Bacteria 9879
25 Ga0466709_237114 3300042648 Bacteria 4992
26 Ga0466708_011017 3300042652 Bacteria 14569
27 Ga0466708_023581 3300042652 Bacteria 13912
28 Ga0466725_012412 3300042654 Bacteria 26917
29 Ga0466711_042337 3300042615 Bacteria 11612
30 Ga0466715_011076 3300042616 Bacteria 39815
31 Ga0466726_381628 3300042619 Bacteria 1642
32 Ga0466726_425750 3300042619 Bacteria 5812
33 Ga0466706_104116 3300042599 Bacteria 2160
34 Ga0466713_020992 3300042602 Bacteria 62959
35 Ga0466713_041013 3300042602 Bacteria 31505
36 Ga0466713_042563 3300042602 Bacteria 4835
37 Ga0466713_045976 3300042602 Bacteria 17693
38 Ga0466714_101114 3300042603 Bacteria 64102
39 Ga0466716_205292 3300042605 Bacteria 9662
40 Ga0466716_432952 3300042605 Bacteria 18137
41 Ga0466719_034225 3300042606 Bacteria 4547
42 Ga0466722_250015 3300042609 Bacteria 6140
43 Ga0466690_079419 3300042590 Bacteria 8245
44 Ga0466690_253817 3300042590 Bacteria 10765
45 2227485761 2225789004 Bacteria 21098
46 JGI24702J35022_10063737 3300002462 Unclassified 1975
47 Ga0466705_091070 3300042612 Bacteria 9169
48 Ga0466705_269867 3300042612 Bacteria 9669
49 Ga0466735_002456 3300042624 Bacteria 12388
50 Ga0466703_115451 3300042636 Bacteria 15572
51 Ga0466703_138188 3300042636 Bacteria 2511
52 Ga0466703_170324 3300042636 Bacteria 10917
53 Ga0466703_243131 3300042636 Bacteria 10151
54 Ga0466703_355752 3300042636 Bacteria 31206
55 Ga0466704_067267 3300042643 Bacteria 9780
56 Ga0466704_068713 3300042643 Bacteria 9150
57 Ga0466704_194366 3300042643 Unclassified 3050
58 Ga0466709_275349 3300042648 Unclassified 4986
59 Ga0466727_090010 3300042655 Bacteria 8453
60 Ga0466727_106023 3300042655 Bacteria 80602
61 Ga0466727_120961 3300042655 Bacteria 5719
62 Ga0466711_366323 3300042615 Bacteria 5068
63 Ga0466711_413491 3300042615 Bacteria 3847
64 Ga0466715_621995 3300042616 Bacteria 20259
65 Ga0466723_125525 3300042618 Bacteria 14542
66 Ga0466723_139753 3300042618 Bacteria 7524
67 Ga0466726_065998 3300042619 Bacteria 18305
68 Ga0466726_120409 3300042619 Bacteria 3024
69 Ga0466728_288205 3300042620 Bacteria 17761
70 Ga0466706_136031 3300042599 Bacteria 7859
71 Ga0466707_151862 3300042601 Bacteria 14895
72 Ga0466707_348434 3300042601 Bacteria 30347
73 Ga0466713_140350 3300042602 Bacteria 7565
74 Ga0466713_149568 3300042602 Bacteria 40583
75 Ga0466719_065914 3300042606 Unclassified 2624
76 Ga0466719_364311 3300042606 Bacteria 8124
77 Ga0466719_380362 3300042606 Bacteria 4936
78 Ga0466722_042291 3300042609 Bacteria 10618
79 Ga0466722_154429 3300042609 Bacteria 2167
80 Ga0466692_051369 3300042591 Bacteria 55044
81 Ga0466691_103420 3300042593 Bacteria 10591
82 Ga0466696_105777 3300042596 Bacteria 41166
83 IMNBL1DRAFT_c0000269 3300000062 Bacteria 45968
84 Ga0123357_10008089 3300009784 Bacteria 13100
85 Ga0123356_10011293 3300010049 Bacteria 8715
86 Ga0123354_10000458 3300010882 Bacteria 40359
87 Ga0466733_060727 3300042659 Bacteria 4796
88 Ga0466735_106449 3300042624 Bacteria 5177
89 Ga0466703_077922 3300042636 Bacteria 14196
90 Ga0466703_157640 3300042636 Bacteria 4313
91 Ga0466703_331251 3300042636 Bacteria 17749
92 Ga0466709_222588 3300042648 Bacteria 4088
93 Ga0466708_226523 3300042652 Unclassified 2595
94 Ga0466727_156758 3300042655 Bacteria 3849
95 Ga0466711_106704 3300042615 Bacteria 17120
96 Ga0466715_611594 3300042616 Bacteria 9251
97 Ga0466718_050419 3300042617 Archaea 1874
98 Ga0466706_054115 3300042599 Bacteria 9491
99 Ga0466707_047433 3300042601 Bacteria 3983
100 Ga0466707_228601 3300042601 Bacteria 32570
101 Ga0466707_337488 3300042601 Bacteria 18461
102 Ga0466713_021134 3300042602 Bacteria 7003
103 Ga0466713_094496 3300042602 Bacteria 333875
104 Ga0466713_141379 3300042602 Bacteria 226907
105 Ga0466716_084851 3300042605 Bacteria 10801
106 Ga0466722_037614 3300042609 Bacteria 16563
107 2227509367 2225789004 Bacteria 3599
108 2227610169 2225789004 Bacteria 2268
109 JGI24699J35502_11134208 3300002509 Bacteria 58698
110 Ga0072941_1284603 3300005201 Bacteria 3763
111 Ga0123357_10001158 3300009784 Bacteria 27473
112 Ga0123357_10236774 3300009784 Unclassified 1987
113 Ga0123353_10168727 3300010167 Bacteria 3476
114 Ga0123354_10023165 3300010882 Bacteria 9794
115 Ga0123354_10138946 3300010882 Bacteria 3019
116 Ga0466733_125743 3300042659 Bacteria 5829
117 Ga0466733_190486 3300042659 Bacteria 10295
118 Ga0466705_061537 3300042612 Bacteria 18963
119 Ga0466705_341709 3300042612 Bacteria 4771
120 Ga0466704_350333 3300042643 Bacteria 20772
121 Ga0466704_585542 3300042643 Unclassified 1360
122 Ga0466709_400581 3300042648 Unclassified 6893
123 Ga0466708_108693 3300042652 Bacteria 11910
124 Ga0466727_076192 3300042655 Bacteria 4594
125 Ga0466711_142779 3300042615 Bacteria 2102
126 Ga0466715_007714 3300042616 Bacteria 20281
127 Ga0466715_049562 3300042616 Bacteria 8250
128 Ga0466723_012545 3300042618 Bacteria 9670
129 Ga0466726_289930 3300042619 Bacteria 8500
130 Ga0466729_042328 3300042621 Bacteria 25723
131 Ga0466701_096398 3300042598 Bacteria 39327
132 Ga0466706_132677 3300042599 Bacteria 12681
133 Ga0466707_010317 3300042601 Bacteria 15926
134 Ga0466707_053558 3300042601 Bacteria 5579
135 Ga0466713_047975 3300042602 Bacteria 7761
136 Ga0466716_129554 3300042605 Bacteria 1455
137 Ga0466716_138413 3300042605 Bacteria 6331
138 Ga0466719_433192 3300042606 Bacteria 5396
139 Ga0466722_173548 3300042609 Bacteria 31010
140 Ga0265387_1007643 3300024582 Bacteria 1452
141 Ga0466693_093126 3300042592 Bacteria 3516
142 Ga0466696_141833 3300042596 Bacteria 18307
143 Ga0466696_168764 3300042596 Bacteria 12119
144 JGI24702J35022_10000131 3300002462 Bacteria 37210
145 JGI24702J35022_10001135 3300002462 Bacteria 16563
146 Ga0068305_10073818 3300005083 Bacteria 7042
147 Ga0123357_10000694 3300009784 Bacteria 33749
148 Ga0123357_10076936 3300009784 Bacteria 4404
149 Ga0123357_10241471 3300009784 Bacteria 1955
150 Ga0123357_10375858 3300009784 Bacteria 1326
151 Ga0123354_10124435 3300010882 Bacteria 3304
152 Ga0466705_223789 3300042612 Bacteria 6911
153 Ga0466729_304089 3300042621 Bacteria 3988
154 Ga0466735_104068 3300042624 Bacteria 2198
155 Ga0466735_168265 3300042624 Bacteria 3796
156 Ga0466704_515525 3300042643 Bacteria 3242
157 Ga0466727_260621 3300042655 Bacteria 5744
158 Ga0466711_123903 3300042615 Bacteria 10875
159 Ga0466711_492858 3300042615 Bacteria 3792
160 Ga0466715_323248 3300042616 Bacteria 7339
161 Ga0466715_416650 3300042616 Bacteria 71840
162 Ga0466726_141457 3300042619 Bacteria 39794
163 Ga0466726_319718 3300042619 Bacteria 14297
164 Ga0466706_034227 3300042599 Bacteria 77665
165 Ga0466706_174871 3300042599 Bacteria 20857
166 Ga0466719_206576 3300042606 Bacteria 9122
167 Ga0466690_419789 3300042590 Bacteria 20681
168 Ga0466693_083354 3300042592 Bacteria 1715
169 Ga0466691_130774 3300042593 Bacteria 8173
170 Ga0466696_054052 3300042596 Bacteria 3711
171 Ga0466696_248480 3300042596 Bacteria 8299
172 Ga0466696_467554 3300042596 Bacteria 10777
173 Ga0466699_259958 3300042597 Bacteria 2169
174 2227275225 2225789004 Bacteria 30519
175 Ga0123357_10000769 3300009784 Bacteria 32386
176 Ga0123353_10000503 3300010167 Bacteria 48547
177 Ga0466733_072682 3300042659 Bacteria 5464
178 Ga0562377_0004 3300056842 Bacteria 3525959
179 Ga0466705_023779 3300042612 Bacteria 12423
180 Ga0466705_098264 3300042612 Bacteria 1481
181 Ga0466705_152618 3300042612 Bacteria 16804
182 Ga0466735_024605 3300042624 Bacteria 2471
183 Ga0466702_311378 3300042635 Bacteria 1703
184 Ga0466704_408836 3300042643 Bacteria 6831
185 Ga0466708_031029 3300042652 Bacteria 6130
186 Ga0466711_021252 3300042615 Bacteria 8622
187 Ga0466711_329973 3300042615 Bacteria 7468
188 Ga0466715_138418 3300042616 Bacteria 28149
189 Ga0466723_101754 3300042618 Bacteria 10500
190 Ga0466729_093779 3300042621 Bacteria 4576
191 Ga0466706_034623 3300042599 Bacteria 20734
192 Ga0466707_125409 3300042601 Bacteria 15243
193 Ga0466713_109573 3300042602 Bacteria 6566
194 Ga0466716_327829 3300042605 Bacteria 7964
195 Ga0466722_127247 3300042609 Bacteria 26149
196 Ga0466690_264520 3300042590 Bacteria 31137
197 Ga0466690_322516 3300042590 Bacteria 1632
198 Ga0466692_005288 3300042591 Bacteria 1516
199 Ga0466692_116573 3300042591 Bacteria 8922
200 Ga0466692_159453 3300042591 Bacteria 1559
201 Ga0466693_085995 3300042592 Bacteria 2406
202 Ga0466696_123492 3300042596 Bacteria 14968
203 Ga0466696_224496 3300042596 Bacteria 7456
204 Ga0466696_227170 3300042596 Bacteria 9389
205 2226980371 2225789003 Bacteria 33112
206 IMNBL1DRAFT_c0000345 3300000062 Bacteria 39398
207 IMNBL1DRAFT_c0002283 3300000062 Bacteria 13508
208 IMNBL1DRAFT_c0003364 3300000062 Bacteria 10372
209 JGI24698J34947_10026762 3300002449 Bacteria 3062
210 Ga0068302_10008227 3300005071 Bacteria 3044
211 Ga0068305_10020657 3300005083 Bacteria 24279
212 Ga0068305_10021548 3300005083 Bacteria 32392
213 Ga0123353_10335356 3300010167 Bacteria 2287
214 Ga0123353_10783784 3300010167 Bacteria 1320
215 Ga0466733_025416 3300042659 Bacteria 189255
216 Ga0466733_134752 3300042659 Bacteria 3413
217 Ga0466733_176526 3300042659 Bacteria 102706
218 Ga0466697_140389 3300042611 Bacteria 2101
219 Ga0466705_224252 3300042612 Bacteria 7752
220 Ga0466703_066112 3300042636 Bacteria 22062
221 Ga0466703_112960 3300042636 Unclassified 2009
222 Ga0466703_164206 3300042636 Bacteria 7385
223 Ga0466703_228828 3300042636 Bacteria 2724
224 Ga0466703_403821 3300042636 Bacteria 3332
225 Ga0466704_016776 3300042643 Bacteria 3845
226 Ga0466704_364588 3300042643 Unclassified 6270
227 Ga0466709_013292 3300042648 Bacteria 34325
228 Ga0466708_063949 3300042652 Bacteria 6260
229 Ga0466715_168651 3300042616 Bacteria 7463
230 Ga0466715_197931 3300042616 Bacteria 14798
231 Ga0466715_217657 3300042616 Bacteria 18865
232 Ga0466726_096510 3300042619 Bacteria 17649
233 Ga0466728_432215 3300042620 Bacteria 2686
234 Ga0466729_058024 3300042621 Bacteria 17363
235 Ga0466707_115297 3300042601 Bacteria 11659
236 Ga0466707_223527 3300042601 Bacteria 2774
237 Ga0466707_314492 3300042601 Bacteria 12949
238 Ga0466707_377742 3300042601 Bacteria 6594
239 Ga0466713_008802 3300042602 Bacteria 69616
240 Ga0466713_078329 3300042602 Bacteria 27454
241 Ga0466690_037173 3300042590 Bacteria 22326
242 Ga0466690_213523 3300042590 Bacteria 18139
243 Ga0466692_114059 3300042591 Bacteria 7730
244 Ga0466701_000546 3300042598 Bacteria 7787
245 IMNBL1DRAFT_c0000274 3300000062 Bacteria 45532
246 IMNBL1DRAFT_c0000303 3300000062 Bacteria 41914
247 JGI24699J35502_11133334 3300002509 Bacteria 9904
248 Ga0068302_10203005 3300005071 Bacteria 4127
249 Ga0068305_10003475 3300005083 Bacteria 10580
250 Ga0123356_10012236 3300010049 Bacteria 8338
251 Ga0123356_10094750 3300010049 Bacteria 2852
252 Ga0466735_060599 3300042624 Bacteria 2803
253 Ga0466735_173600 3300042624 Bacteria 4757
254 Ga0466730_036149 3300042625 Bacteria 7760
255 Ga0466730_076180 3300042625 Bacteria 3323
256 Ga0466704_002372 3300042643 Bacteria 57196
257 Ga0466704_055202 3300042643 Bacteria 5738
258 Ga0466704_162945 3300042643 Bacteria 4788
259 Ga0466704_196953 3300042643 Bacteria 20194
260 Ga0466708_117511 3300042652 Bacteria 28515
261 Ga0466727_170229 3300042655 Bacteria 6312
262 Ga0466727_297080 3300042655 Bacteria 5321
263 Ga0466711_086618 3300042615 Bacteria 2025
264 Ga0466711_286714 3300042615 Bacteria 23462
265 Ga0466715_429111 3300042616 Bacteria 6362
266 Ga0466723_095121 3300042618 Bacteria 177949
267 Ga0466723_136332 3300042618 Bacteria 15291
268 Ga0466723_182664 3300042618 Bacteria 13551
269 Ga0466723_253302 3300042618 Bacteria 1927
270 Ga0466726_206436 3300042619 Bacteria 2443

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II 341 435 0.97
PF01855 POR_N Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg 102 284 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01855 GO:0016491 oxidoreductase activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.