Protein Family IF06064
Metagenome
Isolate
308
Members
88
Samples
270
Scaffolds
360.71
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_045976|Ga0466713_045976_13550_14893
- Length
- 447 aa
- Sequence
- LARQWRQAYCWDFWAKKALHLFVETQIFAMNVCVFFQNSAINNLCAAFFHKKAFFKAILQGFSISTLLFSEKVVPLPSVTRNVLSMTEEIKLLKGNEAIALAAIRYGADGYFGYPITPQSEIMETLMEEMPWTTTGMVVLQAESEVAAINMVYGGAACGKRVMTSSSSPGISLKQEGISFMAGGELPGLIVNVMRGGPGLGTIQPSQSDYFQTVKGGGHGDYKLITLAPASVQEMADHVVLAFDLSFKYRNPAMILTDGVIGQMMEKVILPPQRARRTDDEIRKECPWAALGKPANRPPNIHSSLELDSQRMEQNNLRFQAKYRQIEANETRGEEYRCEDAEYLIVAFGSAARISQKVVDMARAKGMKIGLFRPITLYPFPVRELYSYVGKIKKILCLELNAGQMIEDVKLAVECRIPTIHYGRLGGIIPTPQEVLDKVEKLQTEQQ
Sample Types
Isolate
12.3%
Metagenome
87.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
38.4%
Termitidae
22.1%
Kalotermitidae
16.3%
Unclassified
8.1%
Termopsidae
4.7%
Rhinotermitidae
4.7%
Passalidae
3.5%
Hodotermitidae
1.2%
Tenebrionidae
1.2%
Taxonomy
Archaea
1
Bacteria
296
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 4 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 16 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 17 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 18 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 19 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 24 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 25 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 26 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 27 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 28 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 29 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 43 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 44 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 45 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 46 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 47 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 50 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 51 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 54 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 55 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 56 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 57 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 58 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 59 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 60 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 61 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 63 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 64 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 65 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 66 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 67 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 68 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 69 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 70 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 71 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 72 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 73 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 74 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 75 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 76 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 77 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 78 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 79 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 80 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 81 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 82 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 83 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 84 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 85 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 86 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 87 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 88 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_006953 | 3300042599 | Bacteria | 11042 |
| 2 | Ga0466700_392445 | 3300042600 | Bacteria | 26880 |
| 3 | Ga0466707_151700 | 3300042601 | Bacteria | 16468 |
| 4 | Ga0466713_037701 | 3300042602 | Bacteria | 30244 |
| 5 | Ga0466713_061927 | 3300042602 | Bacteria | 3913 |
| 6 | Ga0466717_156770 | 3300042604 | Bacteria | 2511 |
| 7 | Ga0466722_023479 | 3300042609 | Bacteria | 103035 |
| 8 | Ga0466722_108746 | 3300042609 | Bacteria | 15437 |
| 9 | Ga0466690_027177 | 3300042590 | Bacteria | 32769 |
| 10 | Ga0466692_166187 | 3300042591 | Bacteria | 20656 |
| 11 | Ga0466691_199211 | 3300042593 | Bacteria | 19849 |
| 12 | Ga0466696_488609 | 3300042596 | Bacteria | 4358 |
| 13 | IMNBL1DRAFT_c0000270 | 3300000062 | Bacteria | 45954 |
| 14 | Ga0123357_10146126 | 3300009784 | Unclassified | 2887 |
| 15 | Ga0123354_10118574 | 3300010882 | Bacteria | 3435 |
| 16 | Ga0466705_125056 | 3300042612 | Bacteria | 16098 |
| 17 | Ga0466729_217293 | 3300042621 | Bacteria | 5729 |
| 18 | Ga0466735_105515 | 3300042624 | Bacteria | 7803 |
| 19 | Ga0466735_206696 | 3300042624 | Bacteria | 3272 |
| 20 | Ga0466703_212954 | 3300042636 | Bacteria | 10233 |
| 21 | Ga0466704_176646 | 3300042643 | Bacteria | 62821 |
| 22 | Ga0466704_353772 | 3300042643 | Bacteria | 9855 |
| 23 | Ga0466709_060912 | 3300042648 | Bacteria | 22527 |
| 24 | Ga0466709_186617 | 3300042648 | Bacteria | 9879 |
| 25 | Ga0466709_237114 | 3300042648 | Bacteria | 4992 |
| 26 | Ga0466708_011017 | 3300042652 | Bacteria | 14569 |
| 27 | Ga0466708_023581 | 3300042652 | Bacteria | 13912 |
| 28 | Ga0466725_012412 | 3300042654 | Bacteria | 26917 |
| 29 | Ga0466711_042337 | 3300042615 | Bacteria | 11612 |
| 30 | Ga0466715_011076 | 3300042616 | Bacteria | 39815 |
| 31 | Ga0466726_381628 | 3300042619 | Bacteria | 1642 |
| 32 | Ga0466726_425750 | 3300042619 | Bacteria | 5812 |
| 33 | Ga0466706_104116 | 3300042599 | Bacteria | 2160 |
| 34 | Ga0466713_020992 | 3300042602 | Bacteria | 62959 |
| 35 | Ga0466713_041013 | 3300042602 | Bacteria | 31505 |
| 36 | Ga0466713_042563 | 3300042602 | Bacteria | 4835 |
| 37 | Ga0466713_045976 | 3300042602 | Bacteria | 17693 |
| 38 | Ga0466714_101114 | 3300042603 | Bacteria | 64102 |
| 39 | Ga0466716_205292 | 3300042605 | Bacteria | 9662 |
| 40 | Ga0466716_432952 | 3300042605 | Bacteria | 18137 |
| 41 | Ga0466719_034225 | 3300042606 | Bacteria | 4547 |
| 42 | Ga0466722_250015 | 3300042609 | Bacteria | 6140 |
| 43 | Ga0466690_079419 | 3300042590 | Bacteria | 8245 |
| 44 | Ga0466690_253817 | 3300042590 | Bacteria | 10765 |
| 45 | 2227485761 | 2225789004 | Bacteria | 21098 |
| 46 | JGI24702J35022_10063737 | 3300002462 | Unclassified | 1975 |
| 47 | Ga0466705_091070 | 3300042612 | Bacteria | 9169 |
| 48 | Ga0466705_269867 | 3300042612 | Bacteria | 9669 |
| 49 | Ga0466735_002456 | 3300042624 | Bacteria | 12388 |
| 50 | Ga0466703_115451 | 3300042636 | Bacteria | 15572 |
| 51 | Ga0466703_138188 | 3300042636 | Bacteria | 2511 |
| 52 | Ga0466703_170324 | 3300042636 | Bacteria | 10917 |
| 53 | Ga0466703_243131 | 3300042636 | Bacteria | 10151 |
| 54 | Ga0466703_355752 | 3300042636 | Bacteria | 31206 |
| 55 | Ga0466704_067267 | 3300042643 | Bacteria | 9780 |
| 56 | Ga0466704_068713 | 3300042643 | Bacteria | 9150 |
| 57 | Ga0466704_194366 | 3300042643 | Unclassified | 3050 |
| 58 | Ga0466709_275349 | 3300042648 | Unclassified | 4986 |
| 59 | Ga0466727_090010 | 3300042655 | Bacteria | 8453 |
| 60 | Ga0466727_106023 | 3300042655 | Bacteria | 80602 |
| 61 | Ga0466727_120961 | 3300042655 | Bacteria | 5719 |
| 62 | Ga0466711_366323 | 3300042615 | Bacteria | 5068 |
| 63 | Ga0466711_413491 | 3300042615 | Bacteria | 3847 |
| 64 | Ga0466715_621995 | 3300042616 | Bacteria | 20259 |
| 65 | Ga0466723_125525 | 3300042618 | Bacteria | 14542 |
| 66 | Ga0466723_139753 | 3300042618 | Bacteria | 7524 |
| 67 | Ga0466726_065998 | 3300042619 | Bacteria | 18305 |
| 68 | Ga0466726_120409 | 3300042619 | Bacteria | 3024 |
| 69 | Ga0466728_288205 | 3300042620 | Bacteria | 17761 |
| 70 | Ga0466706_136031 | 3300042599 | Bacteria | 7859 |
| 71 | Ga0466707_151862 | 3300042601 | Bacteria | 14895 |
| 72 | Ga0466707_348434 | 3300042601 | Bacteria | 30347 |
| 73 | Ga0466713_140350 | 3300042602 | Bacteria | 7565 |
| 74 | Ga0466713_149568 | 3300042602 | Bacteria | 40583 |
| 75 | Ga0466719_065914 | 3300042606 | Unclassified | 2624 |
| 76 | Ga0466719_364311 | 3300042606 | Bacteria | 8124 |
| 77 | Ga0466719_380362 | 3300042606 | Bacteria | 4936 |
| 78 | Ga0466722_042291 | 3300042609 | Bacteria | 10618 |
| 79 | Ga0466722_154429 | 3300042609 | Bacteria | 2167 |
| 80 | Ga0466692_051369 | 3300042591 | Bacteria | 55044 |
| 81 | Ga0466691_103420 | 3300042593 | Bacteria | 10591 |
| 82 | Ga0466696_105777 | 3300042596 | Bacteria | 41166 |
| 83 | IMNBL1DRAFT_c0000269 | 3300000062 | Bacteria | 45968 |
| 84 | Ga0123357_10008089 | 3300009784 | Bacteria | 13100 |
| 85 | Ga0123356_10011293 | 3300010049 | Bacteria | 8715 |
| 86 | Ga0123354_10000458 | 3300010882 | Bacteria | 40359 |
| 87 | Ga0466733_060727 | 3300042659 | Bacteria | 4796 |
| 88 | Ga0466735_106449 | 3300042624 | Bacteria | 5177 |
| 89 | Ga0466703_077922 | 3300042636 | Bacteria | 14196 |
| 90 | Ga0466703_157640 | 3300042636 | Bacteria | 4313 |
| 91 | Ga0466703_331251 | 3300042636 | Bacteria | 17749 |
| 92 | Ga0466709_222588 | 3300042648 | Bacteria | 4088 |
| 93 | Ga0466708_226523 | 3300042652 | Unclassified | 2595 |
| 94 | Ga0466727_156758 | 3300042655 | Bacteria | 3849 |
| 95 | Ga0466711_106704 | 3300042615 | Bacteria | 17120 |
| 96 | Ga0466715_611594 | 3300042616 | Bacteria | 9251 |
| 97 | Ga0466718_050419 | 3300042617 | Archaea | 1874 |
| 98 | Ga0466706_054115 | 3300042599 | Bacteria | 9491 |
| 99 | Ga0466707_047433 | 3300042601 | Bacteria | 3983 |
| 100 | Ga0466707_228601 | 3300042601 | Bacteria | 32570 |
| 101 | Ga0466707_337488 | 3300042601 | Bacteria | 18461 |
| 102 | Ga0466713_021134 | 3300042602 | Bacteria | 7003 |
| 103 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 104 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 105 | Ga0466716_084851 | 3300042605 | Bacteria | 10801 |
| 106 | Ga0466722_037614 | 3300042609 | Bacteria | 16563 |
| 107 | 2227509367 | 2225789004 | Bacteria | 3599 |
| 108 | 2227610169 | 2225789004 | Bacteria | 2268 |
| 109 | JGI24699J35502_11134208 | 3300002509 | Bacteria | 58698 |
| 110 | Ga0072941_1284603 | 3300005201 | Bacteria | 3763 |
| 111 | Ga0123357_10001158 | 3300009784 | Bacteria | 27473 |
| 112 | Ga0123357_10236774 | 3300009784 | Unclassified | 1987 |
| 113 | Ga0123353_10168727 | 3300010167 | Bacteria | 3476 |
| 114 | Ga0123354_10023165 | 3300010882 | Bacteria | 9794 |
| 115 | Ga0123354_10138946 | 3300010882 | Bacteria | 3019 |
| 116 | Ga0466733_125743 | 3300042659 | Bacteria | 5829 |
| 117 | Ga0466733_190486 | 3300042659 | Bacteria | 10295 |
| 118 | Ga0466705_061537 | 3300042612 | Bacteria | 18963 |
| 119 | Ga0466705_341709 | 3300042612 | Bacteria | 4771 |
| 120 | Ga0466704_350333 | 3300042643 | Bacteria | 20772 |
| 121 | Ga0466704_585542 | 3300042643 | Unclassified | 1360 |
| 122 | Ga0466709_400581 | 3300042648 | Unclassified | 6893 |
| 123 | Ga0466708_108693 | 3300042652 | Bacteria | 11910 |
| 124 | Ga0466727_076192 | 3300042655 | Bacteria | 4594 |
| 125 | Ga0466711_142779 | 3300042615 | Bacteria | 2102 |
| 126 | Ga0466715_007714 | 3300042616 | Bacteria | 20281 |
| 127 | Ga0466715_049562 | 3300042616 | Bacteria | 8250 |
| 128 | Ga0466723_012545 | 3300042618 | Bacteria | 9670 |
| 129 | Ga0466726_289930 | 3300042619 | Bacteria | 8500 |
| 130 | Ga0466729_042328 | 3300042621 | Bacteria | 25723 |
| 131 | Ga0466701_096398 | 3300042598 | Bacteria | 39327 |
| 132 | Ga0466706_132677 | 3300042599 | Bacteria | 12681 |
| 133 | Ga0466707_010317 | 3300042601 | Bacteria | 15926 |
| 134 | Ga0466707_053558 | 3300042601 | Bacteria | 5579 |
| 135 | Ga0466713_047975 | 3300042602 | Bacteria | 7761 |
| 136 | Ga0466716_129554 | 3300042605 | Bacteria | 1455 |
| 137 | Ga0466716_138413 | 3300042605 | Bacteria | 6331 |
| 138 | Ga0466719_433192 | 3300042606 | Bacteria | 5396 |
| 139 | Ga0466722_173548 | 3300042609 | Bacteria | 31010 |
| 140 | Ga0265387_1007643 | 3300024582 | Bacteria | 1452 |
| 141 | Ga0466693_093126 | 3300042592 | Bacteria | 3516 |
| 142 | Ga0466696_141833 | 3300042596 | Bacteria | 18307 |
| 143 | Ga0466696_168764 | 3300042596 | Bacteria | 12119 |
| 144 | JGI24702J35022_10000131 | 3300002462 | Bacteria | 37210 |
| 145 | JGI24702J35022_10001135 | 3300002462 | Bacteria | 16563 |
| 146 | Ga0068305_10073818 | 3300005083 | Bacteria | 7042 |
| 147 | Ga0123357_10000694 | 3300009784 | Bacteria | 33749 |
| 148 | Ga0123357_10076936 | 3300009784 | Bacteria | 4404 |
| 149 | Ga0123357_10241471 | 3300009784 | Bacteria | 1955 |
| 150 | Ga0123357_10375858 | 3300009784 | Bacteria | 1326 |
| 151 | Ga0123354_10124435 | 3300010882 | Bacteria | 3304 |
| 152 | Ga0466705_223789 | 3300042612 | Bacteria | 6911 |
| 153 | Ga0466729_304089 | 3300042621 | Bacteria | 3988 |
| 154 | Ga0466735_104068 | 3300042624 | Bacteria | 2198 |
| 155 | Ga0466735_168265 | 3300042624 | Bacteria | 3796 |
| 156 | Ga0466704_515525 | 3300042643 | Bacteria | 3242 |
| 157 | Ga0466727_260621 | 3300042655 | Bacteria | 5744 |
| 158 | Ga0466711_123903 | 3300042615 | Bacteria | 10875 |
| 159 | Ga0466711_492858 | 3300042615 | Bacteria | 3792 |
| 160 | Ga0466715_323248 | 3300042616 | Bacteria | 7339 |
| 161 | Ga0466715_416650 | 3300042616 | Bacteria | 71840 |
| 162 | Ga0466726_141457 | 3300042619 | Bacteria | 39794 |
| 163 | Ga0466726_319718 | 3300042619 | Bacteria | 14297 |
| 164 | Ga0466706_034227 | 3300042599 | Bacteria | 77665 |
| 165 | Ga0466706_174871 | 3300042599 | Bacteria | 20857 |
| 166 | Ga0466719_206576 | 3300042606 | Bacteria | 9122 |
| 167 | Ga0466690_419789 | 3300042590 | Bacteria | 20681 |
| 168 | Ga0466693_083354 | 3300042592 | Bacteria | 1715 |
| 169 | Ga0466691_130774 | 3300042593 | Bacteria | 8173 |
| 170 | Ga0466696_054052 | 3300042596 | Bacteria | 3711 |
| 171 | Ga0466696_248480 | 3300042596 | Bacteria | 8299 |
| 172 | Ga0466696_467554 | 3300042596 | Bacteria | 10777 |
| 173 | Ga0466699_259958 | 3300042597 | Bacteria | 2169 |
| 174 | 2227275225 | 2225789004 | Bacteria | 30519 |
| 175 | Ga0123357_10000769 | 3300009784 | Bacteria | 32386 |
| 176 | Ga0123353_10000503 | 3300010167 | Bacteria | 48547 |
| 177 | Ga0466733_072682 | 3300042659 | Bacteria | 5464 |
| 178 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 179 | Ga0466705_023779 | 3300042612 | Bacteria | 12423 |
| 180 | Ga0466705_098264 | 3300042612 | Bacteria | 1481 |
| 181 | Ga0466705_152618 | 3300042612 | Bacteria | 16804 |
| 182 | Ga0466735_024605 | 3300042624 | Bacteria | 2471 |
| 183 | Ga0466702_311378 | 3300042635 | Bacteria | 1703 |
| 184 | Ga0466704_408836 | 3300042643 | Bacteria | 6831 |
| 185 | Ga0466708_031029 | 3300042652 | Bacteria | 6130 |
| 186 | Ga0466711_021252 | 3300042615 | Bacteria | 8622 |
| 187 | Ga0466711_329973 | 3300042615 | Bacteria | 7468 |
| 188 | Ga0466715_138418 | 3300042616 | Bacteria | 28149 |
| 189 | Ga0466723_101754 | 3300042618 | Bacteria | 10500 |
| 190 | Ga0466729_093779 | 3300042621 | Bacteria | 4576 |
| 191 | Ga0466706_034623 | 3300042599 | Bacteria | 20734 |
| 192 | Ga0466707_125409 | 3300042601 | Bacteria | 15243 |
| 193 | Ga0466713_109573 | 3300042602 | Bacteria | 6566 |
| 194 | Ga0466716_327829 | 3300042605 | Bacteria | 7964 |
| 195 | Ga0466722_127247 | 3300042609 | Bacteria | 26149 |
| 196 | Ga0466690_264520 | 3300042590 | Bacteria | 31137 |
| 197 | Ga0466690_322516 | 3300042590 | Bacteria | 1632 |
| 198 | Ga0466692_005288 | 3300042591 | Bacteria | 1516 |
| 199 | Ga0466692_116573 | 3300042591 | Bacteria | 8922 |
| 200 | Ga0466692_159453 | 3300042591 | Bacteria | 1559 |
| 201 | Ga0466693_085995 | 3300042592 | Bacteria | 2406 |
| 202 | Ga0466696_123492 | 3300042596 | Bacteria | 14968 |
| 203 | Ga0466696_224496 | 3300042596 | Bacteria | 7456 |
| 204 | Ga0466696_227170 | 3300042596 | Bacteria | 9389 |
| 205 | 2226980371 | 2225789003 | Bacteria | 33112 |
| 206 | IMNBL1DRAFT_c0000345 | 3300000062 | Bacteria | 39398 |
| 207 | IMNBL1DRAFT_c0002283 | 3300000062 | Bacteria | 13508 |
| 208 | IMNBL1DRAFT_c0003364 | 3300000062 | Bacteria | 10372 |
| 209 | JGI24698J34947_10026762 | 3300002449 | Bacteria | 3062 |
| 210 | Ga0068302_10008227 | 3300005071 | Bacteria | 3044 |
| 211 | Ga0068305_10020657 | 3300005083 | Bacteria | 24279 |
| 212 | Ga0068305_10021548 | 3300005083 | Bacteria | 32392 |
| 213 | Ga0123353_10335356 | 3300010167 | Bacteria | 2287 |
| 214 | Ga0123353_10783784 | 3300010167 | Bacteria | 1320 |
| 215 | Ga0466733_025416 | 3300042659 | Bacteria | 189255 |
| 216 | Ga0466733_134752 | 3300042659 | Bacteria | 3413 |
| 217 | Ga0466733_176526 | 3300042659 | Bacteria | 102706 |
| 218 | Ga0466697_140389 | 3300042611 | Bacteria | 2101 |
| 219 | Ga0466705_224252 | 3300042612 | Bacteria | 7752 |
| 220 | Ga0466703_066112 | 3300042636 | Bacteria | 22062 |
| 221 | Ga0466703_112960 | 3300042636 | Unclassified | 2009 |
| 222 | Ga0466703_164206 | 3300042636 | Bacteria | 7385 |
| 223 | Ga0466703_228828 | 3300042636 | Bacteria | 2724 |
| 224 | Ga0466703_403821 | 3300042636 | Bacteria | 3332 |
| 225 | Ga0466704_016776 | 3300042643 | Bacteria | 3845 |
| 226 | Ga0466704_364588 | 3300042643 | Unclassified | 6270 |
| 227 | Ga0466709_013292 | 3300042648 | Bacteria | 34325 |
| 228 | Ga0466708_063949 | 3300042652 | Bacteria | 6260 |
| 229 | Ga0466715_168651 | 3300042616 | Bacteria | 7463 |
| 230 | Ga0466715_197931 | 3300042616 | Bacteria | 14798 |
| 231 | Ga0466715_217657 | 3300042616 | Bacteria | 18865 |
| 232 | Ga0466726_096510 | 3300042619 | Bacteria | 17649 |
| 233 | Ga0466728_432215 | 3300042620 | Bacteria | 2686 |
| 234 | Ga0466729_058024 | 3300042621 | Bacteria | 17363 |
| 235 | Ga0466707_115297 | 3300042601 | Bacteria | 11659 |
| 236 | Ga0466707_223527 | 3300042601 | Bacteria | 2774 |
| 237 | Ga0466707_314492 | 3300042601 | Bacteria | 12949 |
| 238 | Ga0466707_377742 | 3300042601 | Bacteria | 6594 |
| 239 | Ga0466713_008802 | 3300042602 | Bacteria | 69616 |
| 240 | Ga0466713_078329 | 3300042602 | Bacteria | 27454 |
| 241 | Ga0466690_037173 | 3300042590 | Bacteria | 22326 |
| 242 | Ga0466690_213523 | 3300042590 | Bacteria | 18139 |
| 243 | Ga0466692_114059 | 3300042591 | Bacteria | 7730 |
| 244 | Ga0466701_000546 | 3300042598 | Bacteria | 7787 |
| 245 | IMNBL1DRAFT_c0000274 | 3300000062 | Bacteria | 45532 |
| 246 | IMNBL1DRAFT_c0000303 | 3300000062 | Bacteria | 41914 |
| 247 | JGI24699J35502_11133334 | 3300002509 | Bacteria | 9904 |
| 248 | Ga0068302_10203005 | 3300005071 | Bacteria | 4127 |
| 249 | Ga0068305_10003475 | 3300005083 | Bacteria | 10580 |
| 250 | Ga0123356_10012236 | 3300010049 | Bacteria | 8338 |
| 251 | Ga0123356_10094750 | 3300010049 | Bacteria | 2852 |
| 252 | Ga0466735_060599 | 3300042624 | Bacteria | 2803 |
| 253 | Ga0466735_173600 | 3300042624 | Bacteria | 4757 |
| 254 | Ga0466730_036149 | 3300042625 | Bacteria | 7760 |
| 255 | Ga0466730_076180 | 3300042625 | Bacteria | 3323 |
| 256 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 257 | Ga0466704_055202 | 3300042643 | Bacteria | 5738 |
| 258 | Ga0466704_162945 | 3300042643 | Bacteria | 4788 |
| 259 | Ga0466704_196953 | 3300042643 | Bacteria | 20194 |
| 260 | Ga0466708_117511 | 3300042652 | Bacteria | 28515 |
| 261 | Ga0466727_170229 | 3300042655 | Bacteria | 6312 |
| 262 | Ga0466727_297080 | 3300042655 | Bacteria | 5321 |
| 263 | Ga0466711_086618 | 3300042615 | Bacteria | 2025 |
| 264 | Ga0466711_286714 | 3300042615 | Bacteria | 23462 |
| 265 | Ga0466715_429111 | 3300042616 | Bacteria | 6362 |
| 266 | Ga0466723_095121 | 3300042618 | Bacteria | 177949 |
| 267 | Ga0466723_136332 | 3300042618 | Bacteria | 15291 |
| 268 | Ga0466723_182664 | 3300042618 | Bacteria | 13551 |
| 269 | Ga0466723_253302 | 3300042618 | Bacteria | 1927 |
| 270 | Ga0466726_206436 | 3300042619 | Bacteria | 2443 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01855 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.