Protein Family IF06042
Metagenome
Isolate
205
Members
91
Samples
170
Scaffolds
338.9
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_026099|Ga0466713_026099_2545_3747
- Length
- 386 aa
- Sequence
- MKQIATKDAVGNVLCHDITQIVPGQFKGARFTKGHVVTEEDIPVLLSLGKEHLYVWEKDDRMYHENEAAGILYRICVGEDGGGCFAAGEPSEGKINITAAMDGLLKADAPLQDALNGMGELVIASRHGNTTVKKGDLICGTRVVPLVIEKAKMERAVAAAAGRPIFRLLPFKKKRVGLVTTGTEVFLGRIEDKFGPVLRAKVEEFGSEIMGQTITDDDPAHIEEAIRSFLEKGADMVLCSGGMSVDPDDRTPLAVRNSVSRVVSYGAPVLPGSMLMLGYVDPEGQDALGNDSQPTSAVGSVASGAMEFGLGVTNAAVSAAPRPPIPVVGLPGCVMYSGRTIFDLVLPRLLADDPVTHEDMARMGRGGLCLKCPTCTFPNCGFGKGA
Sample Types
Isolate
17.1%
Metagenome
82.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.6%
Blattidae
16.7%
Kalotermitidae
16.7%
Unclassified
15.5%
Tenebrionidae
7.1%
Termopsidae
3.6%
Rhinotermitidae
2.4%
Passalidae
2.4%
Formicidae
2.4%
Libellulidae
1.2%
Drosophilidae
1.2%
Hodotermitidae
1.2%
Gomphidae
1.2%
Taxonomy
Archaea
1
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 2 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 8 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 9 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 10 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 11 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 12 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 13 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 20 | 2820633305 | Unclassified Firmicutes Emb289P1bin118 | Isolate | Unclassified |
| 21 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 26 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 31 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 32 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 33 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 34 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 41 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 46 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 47 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 48 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 49 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 50 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 51 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 52 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 53 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 59 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 60 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 61 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 62 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 63 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 64 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 65 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 66 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 67 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 68 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 69 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 75 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 76 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 77 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 78 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 79 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 80 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 81 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 82 | 2820729191 | Unclassified Chloroflexi Th196P4bin49 | Isolate | Unclassified |
| 83 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 84 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 85 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 86 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 87 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 88 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 89 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 90 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 91 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_283290 | 3300042656 | Bacteria | 2731 |
| 2 | Ga0562374_2226 | 3300057007 | Bacteria | 18017 |
| 3 | Ga0466704_263964 | 3300042643 | Bacteria | 3235 |
| 4 | Ga0466709_090056 | 3300042648 | Bacteria | 7774 |
| 5 | Ga0466708_108901 | 3300042652 | Bacteria | 52993 |
| 6 | Ga0466727_217544 | 3300042655 | Bacteria | 1420 |
| 7 | Ga0466727_334455 | 3300042655 | Bacteria | 5207 |
| 8 | Ga0466705_430813 | 3300042612 | Bacteria | 2014 |
| 9 | Ga0466728_038421 | 3300042620 | Bacteria | 3035 |
| 10 | Ga0123356_10201660 | 3300010049 | Bacteria | 2029 |
| 11 | Ga0123356_10234628 | 3300010049 | Bacteria | 1901 |
| 12 | Ga0123356_10459691 | 3300010049 | Bacteria | 1422 |
| 13 | Ga0123353_10445533 | 3300010167 | Bacteria | 1908 |
| 14 | Ga0264413_109440 | 3300024493 | Bacteria | 7698 |
| 15 | Ga0264413_112332 | 3300024493 | Bacteria | 2865 |
| 16 | Ga0466690_047124 | 3300042590 | Bacteria | 3773 |
| 17 | Ga0466696_226484 | 3300042596 | Bacteria | 17979 |
| 18 | Ga0466707_173413 | 3300042601 | Bacteria | 4570 |
| 19 | Ga0466720_017457 | 3300042607 | Bacteria | 20604 |
| 20 | Ga0466722_068601 | 3300042609 | Archaea | 8995 |
| 21 | IMNBL1DRAFT_c0000220 | 3300000062 | Bacteria | 49966 |
| 22 | JGI24702J35022_10008703 | 3300002462 | Bacteria | 5729 |
| 23 | JGI24702J35022_10018182 | 3300002462 | Bacteria | 3834 |
| 24 | Ga0466705_221402 | 3300042612 | Bacteria | 1672 |
| 25 | Ga0562379_0363 | 3300056790 | Bacteria | 104557 |
| 26 | Ga0562375_0096 | 3300056856 | Bacteria | 273717 |
| 27 | Ga0466705_525308 | 3300042612 | Unclassified | 4364 |
| 28 | Ga0466715_289277 | 3300042616 | Bacteria | 1367 |
| 29 | Ga0466723_049723 | 3300042618 | Bacteria | 2039 |
| 30 | Ga0466723_052397 | 3300042618 | Bacteria | 2341 |
| 31 | Ga0123354_10149406 | 3300010882 | Bacteria | 2840 |
| 32 | Ga0264413_103345 | 3300024493 | Bacteria | 15115 |
| 33 | Ga0466699_250685 | 3300042597 | Bacteria | 5050 |
| 34 | Ga0466717_261730 | 3300042604 | Bacteria | 14011 |
| 35 | Ga0466716_034650 | 3300042605 | Bacteria | 5944 |
| 36 | Ga0562375_0015 | 3300056856 | Bacteria | 1028412 |
| 37 | Ga0562374_0232 | 3300057007 | Bacteria | 117733 |
| 38 | Ga0466734_089252 | 3300042623 | Bacteria | 1827 |
| 39 | Ga0466734_163042 | 3300042623 | Bacteria | 17910 |
| 40 | Ga0466703_069047 | 3300042636 | Bacteria | 18125 |
| 41 | Ga0466703_210075 | 3300042636 | Bacteria | 2933 |
| 42 | Ga0466703_350079 | 3300042636 | Bacteria | 5254 |
| 43 | Ga0466704_025917 | 3300042643 | Bacteria | 3010 |
| 44 | Ga0466704_137252 | 3300042643 | Bacteria | 11127 |
| 45 | Ga0466704_139452 | 3300042643 | Bacteria | 1999 |
| 46 | Ga0466727_299751 | 3300042655 | Bacteria | 1244 |
| 47 | Ga0466712_070917 | 3300042614 | Bacteria | 15304 |
| 48 | Ga0466711_092684 | 3300042615 | Bacteria | 40177 |
| 49 | Ga0123355_10002537 | 3300009826 | Bacteria | 25869 |
| 50 | Ga0123356_10374963 | 3300010049 | Bacteria | 1554 |
| 51 | Ga0123353_10010899 | 3300010167 | Bacteria | 12736 |
| 52 | Ga0123354_10011021 | 3300010882 | Bacteria | 13947 |
| 53 | Ga0466692_035205 | 3300042591 | Bacteria | 2079 |
| 54 | Ga0466693_229656 | 3300042592 | Unclassified | 3972 |
| 55 | Ga0466693_372397 | 3300042592 | Unclassified | 2545 |
| 56 | Ga0466696_004589 | 3300042596 | Bacteria | 3288 |
| 57 | Ga0466696_206987 | 3300042596 | Bacteria | 1774 |
| 58 | Ga0466713_026099 | 3300042602 | Bacteria | 12087 |
| 59 | Ga0466713_111278 | 3300042602 | Bacteria | 43297 |
| 60 | Ga0466719_216267 | 3300042606 | Bacteria | 3435 |
| 61 | JGI24698J34947_10018519 | 3300002449 | Bacteria | 3761 |
| 62 | Ga0072940_1029056 | 3300005200 | Bacteria | 7886 |
| 63 | Ga0466705_184481 | 3300042612 | Unclassified | 23882 |
| 64 | Ga0530661_000322 | 3300056564 | Bacteria | 37126 |
| 65 | Ga0466703_107009 | 3300042636 | Bacteria | 17636 |
| 66 | Ga0466703_122793 | 3300042636 | Bacteria | 7330 |
| 67 | Ga0466704_061531 | 3300042643 | Bacteria | 5898 |
| 68 | Ga0466704_062714 | 3300042643 | Bacteria | 13764 |
| 69 | Ga0466704_063672 | 3300042643 | Bacteria | 4027 |
| 70 | Ga0466704_467128 | 3300042643 | Bacteria | 7485 |
| 71 | Ga0466709_360836 | 3300042648 | Bacteria | 116876 |
| 72 | Ga0466708_015307 | 3300042652 | Bacteria | 6558 |
| 73 | Ga0466715_048882 | 3300042616 | Bacteria | 2840 |
| 74 | Ga0466715_271874 | 3300042616 | Bacteria | 9236 |
| 75 | Ga0466723_179504 | 3300042618 | Bacteria | 2783 |
| 76 | Ga0466726_424318 | 3300042619 | Bacteria | 9917 |
| 77 | Ga0123355_10160102 | 3300009826 | Bacteria | 3393 |
| 78 | Ga0123356_10014796 | 3300010049 | Bacteria | 7491 |
| 79 | Ga0123356_10114592 | 3300010049 | Bacteria | 2610 |
| 80 | Ga0123353_10340583 | 3300010167 | Bacteria | 2265 |
| 81 | Ga0466691_049619 | 3300042593 | Bacteria | 15579 |
| 82 | Ga0466696_133182 | 3300042596 | Bacteria | 1507 |
| 83 | Ga0466696_492632 | 3300042596 | Bacteria | 3283 |
| 84 | Ga0466699_370083 | 3300042597 | Bacteria | 1668 |
| 85 | Ga0466706_155789 | 3300042599 | Bacteria | 2094 |
| 86 | Ga0466707_405371 | 3300042601 | Bacteria | 2934 |
| 87 | Ga0466719_110529 | 3300042606 | Bacteria | 23182 |
| 88 | Ga0466719_211842 | 3300042606 | Bacteria | 16447 |
| 89 | Ga0466722_026700 | 3300042609 | Bacteria | 11792 |
| 90 | Ga0466698_036737 | 3300042610 | Bacteria | 4368 |
| 91 | 2227416933 | 2225789004 | Unclassified | 5656 |
| 92 | Ga0562375_0126 | 3300056856 | Bacteria | 230981 |
| 93 | Ga0562374_0133 | 3300057007 | Bacteria | 186554 |
| 94 | Ga0466703_089065 | 3300042636 | Bacteria | 4497 |
| 95 | Ga0466704_539096 | 3300042643 | Bacteria | 3414 |
| 96 | Ga0466727_025567 | 3300042655 | Bacteria | 1874 |
| 97 | Ga0466712_178139 | 3300042614 | Bacteria | 3454 |
| 98 | Ga0123357_10258348 | 3300009784 | Bacteria | 1847 |
| 99 | Ga0466690_072217 | 3300042590 | Bacteria | 1401 |
| 100 | Ga0466690_251390 | 3300042590 | Bacteria | 2014 |
| 101 | Ga0466700_116120 | 3300042600 | Bacteria | 2235 |
| 102 | Ga0466707_335233 | 3300042601 | Bacteria | 21910 |
| 103 | Ga0466722_237897 | 3300042609 | Bacteria | 1416 |
| 104 | Ga0466705_149033 | 3300042612 | Bacteria | 15839 |
| 105 | Ga0466705_311805 | 3300042612 | Bacteria | 4668 |
| 106 | Ga0466705_474292 | 3300042612 | Bacteria | 8803 |
| 107 | Ga0466711_177484 | 3300042615 | Bacteria | 18577 |
| 108 | Ga0466715_076343 | 3300042616 | Bacteria | 25139 |
| 109 | Ga0466715_312103 | 3300042616 | Bacteria | 52011 |
| 110 | Ga0466726_203949 | 3300042619 | Bacteria | 1691 |
| 111 | Ga0466728_258466 | 3300042620 | Bacteria | 7285 |
| 112 | Ga0123355_10056676 | 3300009826 | Bacteria | 6341 |
| 113 | Ga0123356_10048160 | 3300010049 | Bacteria | 3966 |
| 114 | Ga0123353_10015983 | 3300010167 | Bacteria | 10944 |
| 115 | Ga0123353_10061641 | 3300010167 | Bacteria | 6015 |
| 116 | Ga0123353_10589268 | 3300010167 | Bacteria | 1593 |
| 117 | Ga0466691_090059 | 3300042593 | Bacteria | 7595 |
| 118 | Ga0466696_230557 | 3300042596 | Bacteria | 4794 |
| 119 | Ga0466699_057819 | 3300042597 | Bacteria | 7557 |
| 120 | Ga0466714_067634 | 3300042603 | Bacteria | 1163 |
| 121 | Ga0466719_087573 | 3300042606 | Bacteria | 2788 |
| 122 | Ga0466719_554262 | 3300042606 | Bacteria | 2661 |
| 123 | IMNBL1DRAFT_c0000009 | 3300000062 | Bacteria | 243341 |
| 124 | JGI24695J34938_10031696 | 3300002450 | Bacteria | 2449 |
| 125 | Ga0466697_088510 | 3300042611 | Bacteria | 2286 |
| 126 | Ga0466705_167806 | 3300042612 | Bacteria | 5472 |
| 127 | Ga0466732_379669 | 3300042656 | Bacteria | 1549 |
| 128 | Ga0562377_0462 | 3300056842 | Bacteria | 67757 |
| 129 | Ga0466735_103632 | 3300042624 | Bacteria | 12116 |
| 130 | Ga0466703_088852 | 3300042636 | Bacteria | 17634 |
| 131 | Ga0466704_046043 | 3300042643 | Bacteria | 4275 |
| 132 | Ga0466704_072859 | 3300042643 | Bacteria | 3504 |
| 133 | Ga0466704_254224 | 3300042643 | Bacteria | 11788 |
| 134 | Ga0466704_392840 | 3300042643 | Bacteria | 1783 |
| 135 | Ga0466712_155403 | 3300042614 | Bacteria | 1260 |
| 136 | Ga0466726_360230 | 3300042619 | Bacteria | 33657 |
| 137 | Ga0466728_198217 | 3300042620 | Bacteria | 1219 |
| 138 | Ga0123356_10019394 | 3300010049 | Bacteria | 6446 |
| 139 | Ga0123356_10022380 | 3300010049 | Bacteria | 5970 |
| 140 | Ga0123353_10123505 | 3300010167 | Bacteria | 4161 |
| 141 | Ga0123354_10026191 | 3300010882 | Bacteria | 9196 |
| 142 | Ga0466657_027211 | 3300042582 | Bacteria | 1463 |
| 143 | Ga0466691_172571 | 3300042593 | Bacteria | 5726 |
| 144 | Ga0466696_475774 | 3300042596 | Bacteria | 1918 |
| 145 | Ga0466707_348494 | 3300042601 | Bacteria | 14383 |
| 146 | Ga0466716_461640 | 3300042605 | Bacteria | 5303 |
| 147 | Ga0466719_549337 | 3300042606 | Bacteria | 6650 |
| 148 | Ga0466720_196514 | 3300042607 | Bacteria | 1330 |
| 149 | Ga0466722_249654 | 3300042609 | Bacteria | 2791 |
| 150 | JGI24695J34938_10013336 | 3300002450 | Bacteria | 4321 |
| 151 | JGI24695J34938_10030302 | 3300002450 | Bacteria | 2521 |
| 152 | Ga0466703_065582 | 3300042636 | Bacteria | 3190 |
| 153 | Ga0466703_238067 | 3300042636 | Bacteria | 1174 |
| 154 | Ga0466704_429577 | 3300042643 | Bacteria | 2758 |
| 155 | Ga0466712_246625 | 3300042614 | Bacteria | 1164 |
| 156 | Ga0466711_017246 | 3300042615 | Bacteria | 24552 |
| 157 | Ga0466718_005218 | 3300042617 | Bacteria | 1784 |
| 158 | Ga0466723_369101 | 3300042618 | Bacteria | 5104 |
| 159 | Ga0466728_456972 | 3300042620 | Bacteria | 56351 |
| 160 | Ga0123355_10039159 | 3300009826 | Unclassified | 7710 |
| 161 | Ga0123356_10000389 | 3300010049 | Bacteria | 50169 |
| 162 | Ga0123356_10024421 | 3300010049 | Bacteria | 5689 |
| 163 | Ga0466694_040614 | 3300042594 | Bacteria | 4945 |
| 164 | Ga0466694_171691 | 3300042594 | Bacteria | 2918 |
| 165 | Ga0466722_175858 | 3300042609 | Bacteria | 3215 |
| 166 | 2227397487 | 2225789004 | Bacteria | 5797 |
| 167 | JGI24702J35022_10003187 | 3300002462 | Bacteria | 9928 |
| 168 | JGI24696J40584_12957797 | 3300002834 | Bacteria | 3695 |
| 169 | CVPL010L_1001224 | 3300002932 | Unclassified | 6568 |
| 170 | Ga0072941_1006576 | 3300005201 | Bacteria | 10343 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00994 | MoCF_biosynth | Probable molybdopterin binding domain | 178 | 349 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.