Protein Family IF06033
Metagenome
Isolate
186
Members
58
Samples
176
Scaffolds
412.72
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_022035|Ga0466713_022035_4247_5650
- Length
- 444 aa
- Sequence
- MIDTFAEFKESKNIDRTTLISILEEAFRNVINKMFGTDENYDIIVNPDKGDFEIWRNRRVVPDGEKRNANLEISLSEARAIDPSYEVGEEITEGVDFAGFGRRAVLNLRQALASKILELQKDNVYNKYKNRIGQIVSAEVYQVWKKEVLLLDEEENELILPKLEQIPGDFFRKNESRRAVVVRVDNQNNNPKIILSRTSNLFMQRLFELEVPEINDGLITIRKIARIPGERAKVAVESYDERIDPVGACVGMKGARIHGIVRELCNENIDVVNFTTNTALFIQRALSPAKISSIKIHEAEKKAEVFLRPEEVSLAIGKNGLNIKLAGMLTEYTIDVFRDEDQDIDDIYLEEFSDEIEMWVIDVLKNIGCFTARNVLDMDRAELIEKSDLEESTIDEVLDVLRAEFQTDDEGDYYKGEPAVAPSAQPQTVEADETQQSQAKAEAE
Sample Types
Isolate
5.4%
Metagenome
94.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.0%
Kalotermitidae
24.1%
Unclassified
15.5%
Rhinotermitidae
8.6%
Drosophilidae
5.2%
Blattidae
5.2%
Termopsidae
5.2%
Passalidae
3.4%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
163
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 7 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 8 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 9 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 10 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 15 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 44 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 48 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 49 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 54 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 55 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 56 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 57 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 58 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_075478 | 3300042598 | Bacteria | 63169 |
| 2 | Ga0466700_370187 | 3300042600 | Bacteria | 13155 |
| 3 | Ga0466713_101041 | 3300042602 | Bacteria | 22676 |
| 4 | 2227194702 | 2225789004 | Bacteria | 7846 |
| 5 | JGI24699J35502_11134171 | 3300002509 | Bacteria | 43800 |
| 6 | Ga0466691_054659 | 3300042593 | Bacteria | 12286 |
| 7 | Ga0123357_10010646 | 3300009784 | Bacteria | 11718 |
| 8 | Ga0123353_10078591 | 3300010167 | Bacteria | 5302 |
| 9 | Ga0123354_10001957 | 3300010882 | Bacteria | 26332 |
| 10 | Ga0466734_012705 | 3300042623 | Unclassified | 1191 |
| 11 | Ga0466735_108345 | 3300042624 | Unclassified | 3860 |
| 12 | Ga0466703_044218 | 3300042636 | Unclassified | 2905 |
| 13 | Ga0466704_115337 | 3300042643 | Unclassified | 5712 |
| 14 | Ga0466704_194880 | 3300042643 | Bacteria | 28437 |
| 15 | Ga0466709_160542 | 3300042648 | Bacteria | 33247 |
| 16 | Ga0466727_184423 | 3300042655 | Bacteria | 96228 |
| 17 | Ga0466700_486430 | 3300042600 | Bacteria | 19114 |
| 18 | Ga0466707_270832 | 3300042601 | Bacteria | 16847 |
| 19 | Ga0466722_007433 | 3300042609 | Bacteria | 9152 |
| 20 | Ga0466722_062829 | 3300042609 | Bacteria | 60409 |
| 21 | 2227463562 | 2225789004 | Bacteria | 5303 |
| 22 | JGI24702J35022_10005654 | 3300002462 | Bacteria | 7290 |
| 23 | JGI24705J35276_12223674 | 3300002504 | Bacteria | 2532 |
| 24 | JGI24699J35502_11133905 | 3300002509 | Bacteria | 18660 |
| 25 | Ga0123357_10000608 | 3300009784 | Bacteria | 35490 |
| 26 | Ga0466705_393232 | 3300042612 | Bacteria | 8108 |
| 27 | Ga0466715_347127 | 3300042616 | Bacteria | 29283 |
| 28 | Ga0466728_061829 | 3300042620 | Unclassified | 6207 |
| 29 | Ga0456237_0000012 | 3300041968 | Bacteria | 42362 |
| 30 | Ga0466692_178028 | 3300042591 | Bacteria | 52823 |
| 31 | Ga0466696_001065 | 3300042596 | Bacteria | 27233 |
| 32 | Ga0466696_045491 | 3300042596 | Bacteria | 16251 |
| 33 | Ga0466696_283248 | 3300042596 | Bacteria | 2001 |
| 34 | Ga0123357_10046728 | 3300009784 | Unclassified | 5870 |
| 35 | Ga0123357_10163486 | 3300009784 | Unclassified | 2660 |
| 36 | Ga0123356_10199376 | 3300010049 | Unclassified | 2040 |
| 37 | Ga0123354_10013687 | 3300010882 | Bacteria | 12601 |
| 38 | Ga0466729_222748 | 3300042621 | Bacteria | 1684 |
| 39 | Ga0466729_291077 | 3300042621 | Bacteria | 6599 |
| 40 | Ga0466735_034318 | 3300042624 | Bacteria | 32071 |
| 41 | Ga0466703_242416 | 3300042636 | Bacteria | 29100 |
| 42 | Ga0466703_337195 | 3300042636 | Unclassified | 1962 |
| 43 | Ga0466709_175756 | 3300042648 | Unclassified | 6204 |
| 44 | Ga0466705_146921 | 3300042612 | Bacteria | 2594 |
| 45 | Ga0466733_089411 | 3300042659 | Bacteria | 24735 |
| 46 | Ga0466701_032389 | 3300042598 | Bacteria | 3676 |
| 47 | Ga0466706_007154 | 3300042599 | Bacteria | 5781 |
| 48 | Ga0466707_183664 | 3300042601 | Bacteria | 9147 |
| 49 | Ga0466713_003716 | 3300042602 | Bacteria | 9024 |
| 50 | Ga0466713_058794 | 3300042602 | Bacteria | 46658 |
| 51 | Ga0466713_109303 | 3300042602 | Bacteria | 4573 |
| 52 | Ga0466716_368592 | 3300042605 | Bacteria | 13085 |
| 53 | Ga0466697_055968 | 3300042611 | Bacteria | 6961 |
| 54 | JGI24702J35022_10009197 | 3300002462 | Unclassified | 5557 |
| 55 | Ga0068305_10092271 | 3300005083 | Bacteria | 5232 |
| 56 | Ga0466711_043128 | 3300042615 | Bacteria | 56831 |
| 57 | Ga0466711_170854 | 3300042615 | Bacteria | 3248 |
| 58 | Ga0466690_198941 | 3300042590 | Bacteria | 36398 |
| 59 | Ga0466693_449509 | 3300042592 | Bacteria | 1380 |
| 60 | Ga0466691_179139 | 3300042593 | Bacteria | 6647 |
| 61 | Ga0466729_284308 | 3300042621 | Bacteria | 6333 |
| 62 | Ga0466735_127120 | 3300042624 | Bacteria | 1516 |
| 63 | Ga0466735_137448 | 3300042624 | Bacteria | 2434 |
| 64 | Ga0466704_234435 | 3300042643 | Bacteria | 4362 |
| 65 | Ga0466704_518725 | 3300042643 | Bacteria | 6019 |
| 66 | Ga0466701_017652 | 3300042598 | Bacteria | 77230 |
| 67 | Ga0466700_354582 | 3300042600 | Bacteria | 6573 |
| 68 | Ga0466707_086860 | 3300042601 | Bacteria | 15465 |
| 69 | Ga0466707_109399 | 3300042601 | Bacteria | 38291 |
| 70 | Ga0466707_221207 | 3300042601 | Bacteria | 5596 |
| 71 | Ga0466707_397590 | 3300042601 | Bacteria | 24173 |
| 72 | Ga0466713_076063 | 3300042602 | Bacteria | 37576 |
| 73 | Ga0466719_226361 | 3300042606 | Bacteria | 7607 |
| 74 | IMNBL1DRAFT_c0004863 | 3300000062 | Bacteria | 7901 |
| 75 | Ga0466705_489022 | 3300042612 | Bacteria | 4490 |
| 76 | Ga0466715_039553 | 3300042616 | Bacteria | 11622 |
| 77 | Ga0466726_367016 | 3300042619 | Bacteria | 2931 |
| 78 | Ga0466692_011323 | 3300042591 | Bacteria | 4785 |
| 79 | Ga0466692_117229 | 3300042591 | Bacteria | 56912 |
| 80 | Ga0123354_10000731 | 3300010882 | Bacteria | 35333 |
| 81 | Ga0123354_10155886 | 3300010882 | Unclassified | 2740 |
| 82 | Ga0466735_136106 | 3300042624 | Bacteria | 20578 |
| 83 | Ga0466735_145486 | 3300042624 | Bacteria | 2749 |
| 84 | Ga0466703_022704 | 3300042636 | Bacteria | 2988 |
| 85 | Ga0466703_204432 | 3300042636 | Unclassified | 6478 |
| 86 | Ga0466704_109385 | 3300042643 | Bacteria | 13575 |
| 87 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 88 | Ga0466708_085155 | 3300042652 | Bacteria | 8423 |
| 89 | Ga0466727_223266 | 3300042655 | Unclassified | 2809 |
| 90 | Ga0466727_279703 | 3300042655 | Bacteria | 9453 |
| 91 | Ga0466705_284102 | 3300042612 | Bacteria | 6710 |
| 92 | Ga0466707_182821 | 3300042601 | Bacteria | 20554 |
| 93 | Ga0466707_348055 | 3300042601 | Bacteria | 31580 |
| 94 | Ga0466713_103712 | 3300042602 | Bacteria | 27039 |
| 95 | Ga0466719_207793 | 3300042606 | Bacteria | 5961 |
| 96 | Ga0466719_364015 | 3300042606 | Unclassified | 5408 |
| 97 | IMNBL1DRAFT_c0000232 | 3300000062 | Bacteria | 48886 |
| 98 | Ga0466711_067084 | 3300042615 | Bacteria | 3253 |
| 99 | Ga0466715_606553 | 3300042616 | Unclassified | 4938 |
| 100 | Ga0466726_391203 | 3300042619 | Unclassified | 2554 |
| 101 | Ga0466690_018709 | 3300042590 | Bacteria | 16629 |
| 102 | Ga0466692_054871 | 3300042591 | Bacteria | 17236 |
| 103 | Ga0123357_10004948 | 3300009784 | Bacteria | 15815 |
| 104 | Ga0123357_10006546 | 3300009784 | Bacteria | 14242 |
| 105 | Ga0123357_10084103 | 3300009784 | Unclassified | 4172 |
| 106 | Ga0123356_10245217 | 3300010049 | Bacteria | 1865 |
| 107 | Ga0466729_226767 | 3300042621 | Bacteria | 2972 |
| 108 | Ga0466703_071559 | 3300042636 | Bacteria | 7052 |
| 109 | Ga0466725_323542 | 3300042654 | Bacteria | 20429 |
| 110 | Ga0466701_036771 | 3300042598 | Bacteria | 249987 |
| 111 | Ga0466707_306666 | 3300042601 | Bacteria | 33300 |
| 112 | Ga0466719_004777 | 3300042606 | Bacteria | 29050 |
| 113 | Ga0466719_025131 | 3300042606 | Bacteria | 3570 |
| 114 | Ga0466715_050259 | 3300042616 | Bacteria | 17796 |
| 115 | Ga0466691_207492 | 3300042593 | Bacteria | 23046 |
| 116 | Ga0466735_065965 | 3300042624 | Unclassified | 2032 |
| 117 | Ga0466704_208476 | 3300042643 | Bacteria | 27718 |
| 118 | Ga0466704_530737 | 3300042643 | Bacteria | 62264 |
| 119 | Ga0466700_444780 | 3300042600 | Bacteria | 8343 |
| 120 | Ga0466707_174178 | 3300042601 | Bacteria | 4433 |
| 121 | Ga0466716_327539 | 3300042605 | Bacteria | 3413 |
| 122 | Ga0466719_055936 | 3300042606 | Unclassified | 1424 |
| 123 | Ga0466722_009345 | 3300042609 | Bacteria | 15631 |
| 124 | IMNBL1DRAFT_c0000089 | 3300000062 | Bacteria | 79556 |
| 125 | JGI24699J35502_11134222 | 3300002509 | Bacteria | 70815 |
| 126 | JGI24696J40584_12957540 | 3300002834 | Bacteria | 3566 |
| 127 | JGI24696J40584_12961212 | 3300002834 | Bacteria | 12052 |
| 128 | Ga0104045_1004545 | 3300007085 | Unclassified | 4565 |
| 129 | Ga0104048_1003377 | 3300007143 | Bacteria | 6098 |
| 130 | Ga0104048_1023164 | 3300007143 | Bacteria | 2029 |
| 131 | Ga0123357_10000044 | 3300009784 | Bacteria | 100721 |
| 132 | Ga0466710_173868 | 3300042613 | Bacteria | 3880 |
| 133 | Ga0466715_308255 | 3300042616 | Bacteria | 13742 |
| 134 | Ga0466715_329842 | 3300042616 | Bacteria | 6657 |
| 135 | Ga0466723_088640 | 3300042618 | Bacteria | 27215 |
| 136 | Ga0466723_096407 | 3300042618 | Bacteria | 9683 |
| 137 | Ga0466726_249468 | 3300042619 | Bacteria | 3518 |
| 138 | Ga0466729_167121 | 3300042621 | Bacteria | 12010 |
| 139 | Ga0466690_000900 | 3300042590 | Bacteria | 25440 |
| 140 | Ga0466696_022762 | 3300042596 | Bacteria | 2870 |
| 141 | Ga0123357_10063274 | 3300009784 | Bacteria | 4949 |
| 142 | Ga0123357_10093591 | 3300009784 | Bacteria | 3905 |
| 143 | Ga0123357_10137065 | 3300009784 | Bacteria | 3022 |
| 144 | Ga0123356_10010461 | 3300010049 | Bacteria | 9106 |
| 145 | Ga0123354_10002491 | 3300010882 | Bacteria | 24409 |
| 146 | Ga0123354_10002936 | 3300010882 | Bacteria | 23138 |
| 147 | Ga0123354_10067518 | 3300010882 | Bacteria | 5207 |
| 148 | Ga0466729_247545 | 3300042621 | Bacteria | 6761 |
| 149 | Ga0466735_022385 | 3300042624 | Bacteria | 2613 |
| 150 | Ga0466735_031351 | 3300042624 | Bacteria | 11211 |
| 151 | Ga0466735_089659 | 3300042624 | Bacteria | 3321 |
| 152 | Ga0466703_012871 | 3300042636 | Bacteria | 30811 |
| 153 | Ga0466705_106099 | 3300042612 | Bacteria | 11134 |
| 154 | Ga0466701_032684 | 3300042598 | Unclassified | 5003 |
| 155 | Ga0466701_039977 | 3300042598 | Bacteria | 63641 |
| 156 | Ga0466706_207776 | 3300042599 | Bacteria | 9302 |
| 157 | Ga0466713_002896 | 3300042602 | Bacteria | 13006 |
| 158 | Ga0466713_022035 | 3300042602 | Bacteria | 8797 |
| 159 | Ga0466713_091292 | 3300042602 | Bacteria | 5447 |
| 160 | Ga0466714_041819 | 3300042603 | Bacteria | 104465 |
| 161 | Ga0466722_178165 | 3300042609 | Bacteria | 29947 |
| 162 | IMNBL1DRAFT_c0003235 | 3300000062 | Bacteria | 10646 |
| 163 | Ga0104050_1003906 | 3300007153 | Unclassified | 2523 |
| 164 | Ga0123357_10001424 | 3300009784 | Bacteria | 25370 |
| 165 | Ga0123357_10002273 | 3300009784 | Bacteria | 21284 |
| 166 | Ga0466715_046774 | 3300042616 | Bacteria | 9371 |
| 167 | Ga0466726_060177 | 3300042619 | Bacteria | 18658 |
| 168 | Ga0466690_179175 | 3300042590 | Bacteria | 10302 |
| 169 | Ga0466696_150760 | 3300042596 | Bacteria | 3412 |
| 170 | Ga0123357_10076524 | 3300009784 | Bacteria | 4418 |
| 171 | Ga0123357_10143780 | 3300009784 | Bacteria | 2922 |
| 172 | Ga0123356_10171946 | 3300010049 | Bacteria | 2178 |
| 173 | Ga0466735_015288 | 3300042624 | Bacteria | 4299 |
| 174 | Ga0466735_201878 | 3300042624 | Bacteria | 1926 |
| 175 | Ga0466704_058411 | 3300042643 | Bacteria | 4332 |
| 176 | Ga0466727_172949 | 3300042655 | Bacteria | 2929 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13184 | GO:0003723 | RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.