Protein Family IF06000
Metagenome
Isolate
158
Members
52
Samples
120
Scaffolds
107.66
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_409312|Ga0466707_409312_941_1267
- Length
- 108 aa
- Sequence
- MMMLDLTKENFKEEVLEAEGYVFVDFYGDGCVPCQALMPAVHGFAENYGGGKLKFTSLNTTKARRLAIGQKILGLPVMAIYKDGEKVEEVVKDDATVENIEAMIKKYI
Sample Types
Isolate
24.1%
Metagenome
76.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.6%
Unclassified
28.8%
Blattidae
21.2%
Tenebrionidae
5.8%
Kalotermitidae
3.8%
Passalidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 2 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 3 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 4 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 5 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 12 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 17 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 18 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 19 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 28 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 29 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 30 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 31 | 2820526825 | Unclassified Firmicutes Lab288P1bin16 | Isolate | Unclassified |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 34 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 35 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 36 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 37 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 38 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 39 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 42 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 43 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 45 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 46 | 2820545146 | Unclassified Firmicutes Lab288P1bin104 | Isolate | Unclassified |
| 47 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 48 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 49 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0012 | 3300056842 | Bacteria | 1240899 |
| 2 | Ga0562375_2808 | 3300056856 | Bacteria | 18293 |
| 3 | Ga0466693_019095 | 3300042592 | Bacteria | 1268 |
| 4 | IMNBL1DRAFT_c0076037 | 3300000062 | Bacteria | 953 |
| 5 | JGI24695J34938_10028219 | 3300002450 | Bacteria | 2640 |
| 6 | JGI24702J35022_10011967 | 3300002462 | Bacteria | 4832 |
| 7 | JGI24703J35330_11148231 | 3300002501 | Unclassified | 723 |
| 8 | JGI24703J35330_11148232 | 3300002501 | Bacteria | 723 |
| 9 | Ga0123355_10007346 | 3300009826 | Bacteria | 16501 |
| 10 | Ga0123355_10030320 | 3300009826 | Bacteria | 8764 |
| 11 | Ga0123355_10069419 | 3300009826 | Bacteria | 5664 |
| 12 | Ga0123355_10373570 | 3300009826 | Bacteria | 1865 |
| 13 | Ga0123355_11209600 | 3300009826 | Bacteria | 770 |
| 14 | Ga0123356_12591305 | 3300010049 | Bacteria | 635 |
| 15 | Ga0123353_10288601 | 3300010167 | Bacteria | 2513 |
| 16 | Ga0123353_10311437 | 3300010167 | Bacteria | 2396 |
| 17 | Ga0123353_10642239 | 3300010167 | Bacteria | 1505 |
| 18 | Ga0123354_10713341 | 3300010882 | Bacteria | 697 |
| 19 | Ga0466693_222464 | 3300042592 | Bacteria | 1413 |
| 20 | Ga0466707_409312 | 3300042601 | Bacteria | 4136 |
| 21 | Ga0466725_089115 | 3300042654 | Bacteria | 2089 |
| 22 | Ga0123355_10002238 | 3300009826 | Bacteria | 27304 |
| 23 | Ga0123355_10030027 | 3300009826 | Bacteria | 8808 |
| 24 | Ga0123355_10039406 | 3300009826 | Bacteria | 7687 |
| 25 | Ga0123355_10048272 | 3300009826 | Bacteria | 6922 |
| 26 | Ga0123355_10269314 | 3300009826 | Unclassified | 2369 |
| 27 | Ga0123355_10405127 | 3300009826 | Bacteria | 1755 |
| 28 | Ga0123355_10416975 | 3300009826 | Bacteria | 1719 |
| 29 | Ga0123355_10573311 | 3300009826 | Bacteria | 1353 |
| 30 | Ga0123355_10595624 | 3300009826 | Unclassified | 1314 |
| 31 | Ga0123355_10669335 | 3300009826 | Unclassified | 1204 |
| 32 | Ga0123356_13004139 | 3300010049 | Bacteria | 589 |
| 33 | Ga0123353_10853877 | 3300010167 | Bacteria | 1247 |
| 34 | Ga0123353_10916340 | 3300010167 | Bacteria | 1191 |
| 35 | Ga0123353_11818445 | 3300010167 | Bacteria | 756 |
| 36 | Ga0562378_0021 | 3300056814 | Bacteria | 800040 |
| 37 | Ga0415639_010121 | 3300038395 | Bacteria | 32586 |
| 38 | Ga0466693_154051 | 3300042592 | Bacteria | 3168 |
| 39 | Ga0466697_219928 | 3300042611 | Bacteria | 5968 |
| 40 | Ga0123355_10002190 | 3300009826 | Bacteria | 27570 |
| 41 | Ga0123355_10084848 | 3300009826 | Bacteria | 5042 |
| 42 | Ga0123355_10121681 | 3300009826 | Bacteria | 4046 |
| 43 | Ga0123355_10155179 | 3300009826 | Bacteria | 3466 |
| 44 | Ga0123355_10267989 | 3300009826 | Bacteria | 2378 |
| 45 | Ga0123355_10324822 | 3300009826 | Bacteria | 2068 |
| 46 | Ga0123355_10753334 | 3300009826 | Bacteria | 1100 |
| 47 | Ga0123355_11101673 | 3300009826 | Bacteria | 826 |
| 48 | Ga0123355_11182222 | 3300009826 | Bacteria | 783 |
| 49 | Ga0123356_11849044 | 3300010049 | Bacteria | 751 |
| 50 | Ga0123353_10162883 | 3300010167 | Bacteria | 3549 |
| 51 | Ga0123353_11927443 | 3300010167 | Bacteria | 728 |
| 52 | Ga0466733_115069 | 3300042659 | Bacteria | 1412 |
| 53 | Ga0466713_095526 | 3300042602 | Bacteria | 106941 |
| 54 | Ga0123355_10330617 | 3300009826 | Unclassified | 2042 |
| 55 | Ga0123355_10337983 | 3300009826 | Bacteria | 2009 |
| 56 | Ga0123355_10393261 | 3300009826 | Bacteria | 1795 |
| 57 | Ga0123355_10626930 | 3300009826 | Bacteria | 1265 |
| 58 | Ga0123355_10977532 | 3300009826 | Unclassified | 903 |
| 59 | Ga0123356_12248801 | 3300010049 | Unclassified | 682 |
| 60 | Ga0123353_10004211 | 3300010167 | Bacteria | 18469 |
| 61 | Ga0123353_11023082 | 3300010167 | Bacteria | 1107 |
| 62 | 2227524619 | 2225789004 | Bacteria | 16986 |
| 63 | JGI24702J35022_10000086 | 3300002462 | Bacteria | 41636 |
| 64 | Ga0466715_591419 | 3300042616 | Bacteria | 30861 |
| 65 | Ga0466725_058551 | 3300042654 | Bacteria | 3173 |
| 66 | Ga0123355_10000321 | 3300009826 | Bacteria | 61754 |
| 67 | Ga0123355_10002664 | 3300009826 | Bacteria | 25343 |
| 68 | Ga0123355_11162257 | 3300009826 | Bacteria | 793 |
| 69 | Ga0123355_11355949 | 3300009826 | Bacteria | 708 |
| 70 | Ga0123356_12694219 | 3300010049 | Bacteria | 622 |
| 71 | Ga0123353_10193181 | 3300010167 | Bacteria | 3211 |
| 72 | Ga0123353_10206459 | 3300010167 | Bacteria | 3085 |
| 73 | Ga0123353_11020798 | 3300010167 | Bacteria | 1109 |
| 74 | Ga0123353_12311025 | 3300010167 | Bacteria | 646 |
| 75 | Ga0123353_12360656 | 3300010167 | Unclassified | 637 |
| 76 | Ga0123353_12693527 | 3300010167 | Bacteria | 586 |
| 77 | Ga0466721_066974 | 3300042608 | Bacteria | 1337 |
| 78 | 2227473982 | 2225789004 | Bacteria | 901 |
| 79 | JGI24703J35330_11748283 | 3300002501 | Bacteria | 13053 |
| 80 | Ga0466725_087547 | 3300042654 | Bacteria | 6089 |
| 81 | Ga0123357_10078933 | 3300009784 | Bacteria | 4335 |
| 82 | Ga0123355_10000911 | 3300009826 | Bacteria | 40921 |
| 83 | Ga0123355_10004100 | 3300009826 | Bacteria | 21124 |
| 84 | Ga0123355_10005257 | 3300009826 | Bacteria | 18906 |
| 85 | Ga0123355_10017343 | 3300009826 | Bacteria | 11377 |
| 86 | Ga0123355_10028686 | 3300009826 | Bacteria | 9000 |
| 87 | Ga0123355_10348113 | 3300009826 | Bacteria | 1966 |
| 88 | Ga0123355_11191748 | 3300009826 | Bacteria | 779 |
| 89 | Ga0123356_10462284 | 3300010049 | Bacteria | 1419 |
| 90 | Ga0123353_11246620 | 3300010167 | Bacteria | 971 |
| 91 | Ga0123353_11284172 | 3300010167 | Unclassified | 952 |
| 92 | Ga0123353_11650153 | 3300010167 | Bacteria | 806 |
| 93 | Ga0123353_13264392 | 3300010167 | Bacteria | 518 |
| 94 | Ga0466696_226194 | 3300042596 | Bacteria | 1805 |
| 95 | Ga0466706_019772 | 3300042599 | Bacteria | 18347 |
| 96 | Ga0466706_276905 | 3300042599 | Bacteria | 1439 |
| 97 | Ga0466717_228397 | 3300042604 | Bacteria | 2833 |
| 98 | JGI24695J34938_10020617 | 3300002450 | Bacteria | 3240 |
| 99 | JGI24703J35330_10788920 | 3300002501 | Bacteria | 531 |
| 100 | Ga0466724_19489 | 3300042649 | Unclassified | 1702 |
| 101 | Ga0123355_10003076 | 3300009826 | Bacteria | 23779 |
| 102 | Ga0123355_10016931 | 3300009826 | Bacteria | 11501 |
| 103 | Ga0123355_10017491 | 3300009826 | Bacteria | 11335 |
| 104 | Ga0123355_10157638 | 3300009826 | Bacteria | 3429 |
| 105 | Ga0123356_10076397 | 3300010049 | Bacteria | 3156 |
| 106 | Ga0123356_12614456 | 3300010049 | Bacteria | 632 |
| 107 | Ga0123353_10154855 | 3300010167 | Bacteria | 3655 |
| 108 | Ga0123353_10562040 | 3300010167 | Bacteria | 1642 |
| 109 | Ga0123353_11926835 | 3300010167 | Bacteria | 728 |
| 110 | Ga0466700_231881 | 3300042600 | Bacteria | 1252 |
| 111 | Ga0466713_108291 | 3300042602 | Bacteria | 2146 |
| 112 | JGI24703J35330_11449294 | 3300002501 | Bacteria | 1029 |
| 113 | Ga0123355_10000008 | 3300009826 | Bacteria | 191875 |
| 114 | Ga0123355_10001526 | 3300009826 | Bacteria | 32316 |
| 115 | Ga0123355_10003385 | 3300009826 | Bacteria | 22828 |
| 116 | Ga0123355_10132809 | 3300009826 | Bacteria | 3831 |
| 117 | Ga0123355_10228811 | 3300009826 | Unclassified | 2659 |
| 118 | Ga0123355_11337838 | 3300009826 | Bacteria | 715 |
| 119 | Ga0123356_10124211 | 3300010049 | Bacteria | 2517 |
| 120 | Ga0123353_11645860 | 3300010167 | Bacteria | 807 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00085 | Thioredoxin | Thioredoxin | 4 | 105 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.