Protein Family IF05998
Metagenome
Isolate
230
Members
60
Samples
223
Scaffolds
360.04
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_407003|Ga0466707_407003_4880_6013
- Length
- 377 aa
- Sequence
- MGCELDRIFAGKGNSTMKKALISGVTGQDGAYLSEFLLHKGYEVHGIKRRASSFNTDRIDHLYQDPHEKNKRFFLHYGDLTDTSNIVRIIQEVRPDEIYNLGAQSHVQVSFEVPEYTADADGLGTLRLLEAIRILGMEKKVRLYQASTSELFGKVQEIPQRETTPFYPRSPYAAAKLYAYWIVVNYRESYGMYACNGILFNHESPIRGETFVTRKVTRAAARIKLGLQDKLFMGNIDSKRDWGFAGDYVELMWLMLQQDAPDDYIMATGVTTRVRDFIAMAFAEAGITLKWEGSGVNEKGIDAESGKTLVEIDPKYFRPAEVDILIGDPTKAVTKLGWKPKVQLPELVRMMVKNDLEIAEREIHLKKGGYTIKNYYE
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.3%
Kalotermitidae
23.7%
Unclassified
15.3%
Termopsidae
6.8%
Rhinotermitidae
5.1%
Formicidae
5.1%
Daphniidae
1.7%
Culicidae
1.7%
Hodotermitidae
1.7%
Passalidae
1.7%
Taxonomy
Archaea
0
Bacteria
211
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 17 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 24 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 31 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 37 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 2820215626 | Unclassified Kiritimatiellaeota Nt197P3bin123 | Isolate | Unclassified |
| 50 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 51 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 56 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 57 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 58 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 59 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 60 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | AustNasuHG_c1007559 | 3300000089 | Unclassified | 3858 |
| 2 | Ga0466706_169152 | 3300042599 | Bacteria | 2355 |
| 3 | Ga0160472_100076 | 3300012839 | Bacteria | 162972 |
| 4 | Ga0264413_130018 | 3300024493 | Bacteria | 4642 |
| 5 | Ga0456237_0000880 | 3300041968 | Bacteria | 4722 |
| 6 | Ga0466692_120803 | 3300042591 | Bacteria | 9382 |
| 7 | Ga0466692_183929 | 3300042591 | Bacteria | 5019 |
| 8 | Ga0466691_135981 | 3300042593 | Bacteria | 4333 |
| 9 | Ga0466699_025462 | 3300042597 | Bacteria | 14239 |
| 10 | Ga0466699_051193 | 3300042597 | Bacteria | 5044 |
| 11 | Ga0466699_164791 | 3300042597 | Bacteria | 2677 |
| 12 | Ga0466699_279932 | 3300042597 | Bacteria | 1795 |
| 13 | Ga0466699_425983 | 3300042597 | Bacteria | 2888 |
| 14 | Ga0466702_334994 | 3300042635 | Bacteria | 5067 |
| 15 | Ga0466703_202571 | 3300042636 | Bacteria | 5818 |
| 16 | Ga0466704_252811 | 3300042643 | Bacteria | 3387 |
| 17 | Ga0466709_125856 | 3300042648 | Bacteria | 4414 |
| 18 | Ga0466708_129239 | 3300042652 | Bacteria | 6499 |
| 19 | Ga0466708_348483 | 3300042652 | Bacteria | 6771 |
| 20 | Ga0466718_058641 | 3300042617 | Bacteria | 14058 |
| 21 | Ga0466718_149421 | 3300042617 | Bacteria | 7099 |
| 22 | Ga0466726_032144 | 3300042619 | Bacteria | 3962 |
| 23 | Ga0466728_383692 | 3300042620 | Bacteria | 5957 |
| 24 | Ga0123355_10000659 | 3300009826 | Bacteria | 46817 |
| 25 | AustNasuHG_c1013239 | 3300000089 | Bacteria | 2832 |
| 26 | JGI24702J35022_10021695 | 3300002462 | Bacteria | 3481 |
| 27 | Ga0466707_409008 | 3300042601 | Bacteria | 1947 |
| 28 | Ga0466716_300829 | 3300042605 | Bacteria | 2743 |
| 29 | Ga0466720_046917 | 3300042607 | Bacteria | 61630 |
| 30 | Ga0466720_109839 | 3300042607 | Bacteria | 13943 |
| 31 | Ga0466720_166545 | 3300042607 | Bacteria | 1592 |
| 32 | Ga0466692_066226 | 3300042591 | Bacteria | 16969 |
| 33 | Ga0466692_175042 | 3300042591 | Bacteria | 5723 |
| 34 | Ga0466693_194917 | 3300042592 | Bacteria | 2805 |
| 35 | Ga0466691_006945 | 3300042593 | Bacteria | 10732 |
| 36 | Ga0466691_018555 | 3300042593 | Bacteria | 15185 |
| 37 | Ga0466694_103716 | 3300042594 | Bacteria | 2120 |
| 38 | Ga0466699_118972 | 3300042597 | Bacteria | 29522 |
| 39 | Ga0466699_159096 | 3300042597 | Bacteria | 3493 |
| 40 | Ga0466699_222854 | 3300042597 | Bacteria | 1471 |
| 41 | Ga0466699_386498 | 3300042597 | Bacteria | 3148 |
| 42 | Ga0466704_152795 | 3300042643 | Bacteria | 9678 |
| 43 | Ga0466704_531949 | 3300042643 | Bacteria | 19307 |
| 44 | Ga0466724_25707 | 3300042649 | Bacteria | 20045 |
| 45 | Ga0466711_287934 | 3300042615 | Bacteria | 10820 |
| 46 | Ga0466711_500941 | 3300042615 | Bacteria | 2562 |
| 47 | Ga0466715_049034 | 3300042616 | Bacteria | 21580 |
| 48 | Ga0466715_322538 | 3300042616 | Bacteria | 4870 |
| 49 | Ga0466723_240599 | 3300042618 | Bacteria | 21672 |
| 50 | Ga0466723_265570 | 3300042618 | Bacteria | 2340 |
| 51 | Ga0466726_104369 | 3300042619 | Bacteria | 3307 |
| 52 | Ga0466705_037517 | 3300042612 | Bacteria | 13726 |
| 53 | Ga0123356_10442260 | 3300010049 | Bacteria | 1447 |
| 54 | Ga0123353_10354165 | 3300010167 | Bacteria | 2210 |
| 55 | Ga0123353_10455076 | 3300010167 | Bacteria | 1883 |
| 56 | JGI24695J34938_10019396 | 3300002450 | Bacteria | 3371 |
| 57 | Ga0068302_10249455 | 3300005071 | Bacteria | 3637 |
| 58 | Ga0068305_10013509 | 3300005083 | Bacteria | 19158 |
| 59 | Ga0466707_407003 | 3300042601 | Bacteria | 9031 |
| 60 | Ga0466716_021507 | 3300042605 | Bacteria | 1422 |
| 61 | Ga0466720_111060 | 3300042607 | Bacteria | 15389 |
| 62 | Ga0466690_000156 | 3300042590 | Bacteria | 1551 |
| 63 | Ga0466692_073689 | 3300042591 | Bacteria | 2928 |
| 64 | Ga0466692_181859 | 3300042591 | Bacteria | 4856 |
| 65 | Ga0466691_170012 | 3300042593 | Bacteria | 38393 |
| 66 | Ga0466696_371532 | 3300042596 | Bacteria | 5332 |
| 67 | Ga0466735_038650 | 3300042624 | Bacteria | 16304 |
| 68 | Ga0466704_023429 | 3300042643 | Unclassified | 2315 |
| 69 | Ga0466704_611132 | 3300042643 | Bacteria | 7052 |
| 70 | Ga0466705_429802 | 3300042612 | Bacteria | 4644 |
| 71 | Ga0466726_033777 | 3300042619 | Bacteria | 3078 |
| 72 | Ga0466726_034060 | 3300042619 | Bacteria | 15500 |
| 73 | Ga0466726_109582 | 3300042619 | Bacteria | 4829 |
| 74 | Ga0466726_380703 | 3300042619 | Bacteria | 6982 |
| 75 | Ga0466705_073088 | 3300042612 | Bacteria | 16899 |
| 76 | Ga0466732_047959 | 3300042656 | Unclassified | 10589 |
| 77 | Ga0466732_227977 | 3300042656 | Bacteria | 17179 |
| 78 | 2227289122 | 2225789004 | Bacteria | 6731 |
| 79 | JGI24698J34947_10019534 | 3300002449 | Bacteria | 3655 |
| 80 | JGI24700J35501_10930789 | 3300002508 | Bacteria | 24096 |
| 81 | Ga0466713_091793 | 3300042602 | Bacteria | 7782 |
| 82 | Ga0466717_088342 | 3300042604 | Bacteria | 1567 |
| 83 | Ga0466720_084667 | 3300042607 | Bacteria | 9501 |
| 84 | Ga0264413_113106 | 3300024493 | Bacteria | 6645 |
| 85 | Ga0264413_130176 | 3300024493 | Bacteria | 4769 |
| 86 | Ga0466691_032366 | 3300042593 | Bacteria | 2454 |
| 87 | Ga0466735_013511 | 3300042624 | Bacteria | 1945 |
| 88 | Ga0466703_230351 | 3300042636 | Bacteria | 2426 |
| 89 | Ga0466704_045974 | 3300042643 | Unclassified | 1453 |
| 90 | Ga0466727_167730 | 3300042655 | Bacteria | 2496 |
| 91 | Ga0466727_308651 | 3300042655 | Bacteria | 1636 |
| 92 | Ga0466705_407256 | 3300042612 | Bacteria | 6643 |
| 93 | Ga0466712_023843 | 3300042614 | Bacteria | 22246 |
| 94 | Ga0466712_170058 | 3300042614 | Bacteria | 6603 |
| 95 | Ga0466718_013791 | 3300042617 | Bacteria | 36967 |
| 96 | Ga0466726_314489 | 3300042619 | Bacteria | 6295 |
| 97 | Ga0466726_346816 | 3300042619 | Bacteria | 19893 |
| 98 | Ga0466728_428094 | 3300042620 | Bacteria | 1851 |
| 99 | Ga0466705_155555 | 3300042612 | Bacteria | 10673 |
| 100 | Ga0466705_222525 | 3300042612 | Unclassified | 9497 |
| 101 | Ga0466732_014040 | 3300042656 | Bacteria | 45614 |
| 102 | Ga0123353_10692297 | 3300010167 | Bacteria | 1433 |
| 103 | AustNasuHG_c1005480 | 3300000089 | Unclassified | 4534 |
| 104 | AustNasuHG_c1016618 | 3300000089 | Unclassified | 2458 |
| 105 | JGI24698J34947_10013235 | 3300002449 | Bacteria | 4507 |
| 106 | Ga0068302_10114806 | 3300005071 | Bacteria | 2490 |
| 107 | Ga0466707_339723 | 3300042601 | Bacteria | 5526 |
| 108 | Ga0466719_025223 | 3300042606 | Bacteria | 8914 |
| 109 | Ga0466720_088947 | 3300042607 | Bacteria | 35866 |
| 110 | Ga0466698_019507 | 3300042610 | Bacteria | 1622 |
| 111 | Ga0264413_130029 | 3300024493 | Bacteria | 11639 |
| 112 | Ga0466690_343583 | 3300042590 | Bacteria | 1371 |
| 113 | Ga0466691_141887 | 3300042593 | Bacteria | 2837 |
| 114 | Ga0466699_088613 | 3300042597 | Bacteria | 91931 |
| 115 | Ga0466699_103184 | 3300042597 | Bacteria | 50050 |
| 116 | Ga0466729_254100 | 3300042621 | Bacteria | 4005 |
| 117 | Ga0466735_005020 | 3300042624 | Bacteria | 1497 |
| 118 | Ga0466730_103184 | 3300042625 | Bacteria | 430539 |
| 119 | Ga0466703_359855 | 3300042636 | Bacteria | 2337 |
| 120 | Ga0466709_159182 | 3300042648 | Bacteria | 5192 |
| 121 | Ga0466708_167407 | 3300042652 | Bacteria | 4512 |
| 122 | Ga0466712_052579 | 3300042614 | Bacteria | 20988 |
| 123 | Ga0466711_222211 | 3300042615 | Bacteria | 23711 |
| 124 | Ga0466711_405393 | 3300042615 | Bacteria | 5102 |
| 125 | Ga0466715_096909 | 3300042616 | Bacteria | 3898 |
| 126 | Ga0466715_187074 | 3300042616 | Bacteria | 2062 |
| 127 | Ga0466726_062635 | 3300042619 | Bacteria | 4645 |
| 128 | Ga0466728_448040 | 3300042620 | Bacteria | 14502 |
| 129 | Ga0466705_069379 | 3300042612 | Bacteria | 11811 |
| 130 | Ga0466705_071801 | 3300042612 | Unclassified | 10473 |
| 131 | Ga0466705_368462 | 3300042612 | Bacteria | 5994 |
| 132 | Ga0123353_10014823 | 3300010167 | Unclassified | 11271 |
| 133 | Ga0123353_10688150 | 3300010167 | Bacteria | 1438 |
| 134 | AustNasuHG_c1009754 | 3300000089 | Bacteria | 3362 |
| 135 | AustNasuHG_c1024734 | 3300000089 | Unclassified | 1898 |
| 136 | CVPL010W_10000014 | 3300002931 | Bacteria | 89080 |
| 137 | Ga0466706_007687 | 3300042599 | Bacteria | 2493 |
| 138 | Ga0466707_343058 | 3300042601 | Bacteria | 2187 |
| 139 | Ga0466719_241815 | 3300042606 | Bacteria | 12515 |
| 140 | Ga0466720_112435 | 3300042607 | Bacteria | 45324 |
| 141 | Ga0466720_145662 | 3300042607 | Bacteria | 157622 |
| 142 | Ga0466720_203223 | 3300042607 | Bacteria | 14766 |
| 143 | Ga0466691_047325 | 3300042593 | Bacteria | 2378 |
| 144 | Ga0466691_073673 | 3300042593 | Bacteria | 3268 |
| 145 | Ga0466691_217074 | 3300042593 | Bacteria | 7694 |
| 146 | Ga0466703_182948 | 3300042636 | Bacteria | 14030 |
| 147 | Ga0466704_074570 | 3300042643 | Bacteria | 2648 |
| 148 | Ga0466708_051941 | 3300042652 | Bacteria | 9560 |
| 149 | Ga0466708_420903 | 3300042652 | Bacteria | 1421 |
| 150 | Ga0466715_582525 | 3300042616 | Bacteria | 12290 |
| 151 | Ga0466718_129224 | 3300042617 | Bacteria | 36457 |
| 152 | Ga0466726_233406 | 3300042619 | Bacteria | 1410 |
| 153 | Ga0466726_383371 | 3300042619 | Bacteria | 24063 |
| 154 | Ga0466726_393190 | 3300042619 | Bacteria | 2408 |
| 155 | JGI24695J34938_10010631 | 3300002450 | Bacteria | 5022 |
| 156 | JGI24695J34938_10034656 | 3300002450 | Bacteria | 2314 |
| 157 | JGI24702J35022_10005854 | 3300002462 | Bacteria | 7151 |
| 158 | Ga0466707_307614 | 3300042601 | Bacteria | 54795 |
| 159 | Ga0466719_119570 | 3300042606 | Unclassified | 2116 |
| 160 | Ga0466719_536782 | 3300042606 | Bacteria | 22487 |
| 161 | Ga0466720_012895 | 3300042607 | Bacteria | 75127 |
| 162 | Ga0466720_131560 | 3300042607 | Bacteria | 48024 |
| 163 | Ga0264413_144475 | 3300024493 | Bacteria | 6139 |
| 164 | Ga0466690_188657 | 3300042590 | Bacteria | 1688 |
| 165 | Ga0466691_160775 | 3300042593 | Bacteria | 10837 |
| 166 | Ga0466695_175366 | 3300042595 | Bacteria | 1542 |
| 167 | Ga0466699_140004 | 3300042597 | Bacteria | 9722 |
| 168 | Ga0466702_278760 | 3300042635 | Bacteria | 1648 |
| 169 | Ga0466703_046479 | 3300042636 | Bacteria | 1882 |
| 170 | Ga0466704_533230 | 3300042643 | Bacteria | 3574 |
| 171 | Ga0466724_37932 | 3300042649 | Bacteria | 325221 |
| 172 | Ga0466708_115688 | 3300042652 | Bacteria | 7560 |
| 173 | Ga0466727_154470 | 3300042655 | Bacteria | 5561 |
| 174 | Ga0466727_181029 | 3300042655 | Bacteria | 14375 |
| 175 | Ga0466712_255603 | 3300042614 | Bacteria | 2230 |
| 176 | Ga0466711_506740 | 3300042615 | Bacteria | 9051 |
| 177 | Ga0466715_383273 | 3300042616 | Bacteria | 14984 |
| 178 | Ga0466715_436538 | 3300042616 | Unclassified | 2659 |
| 179 | Ga0466726_107116 | 3300042619 | Bacteria | 1978 |
| 180 | Ga0466726_121530 | 3300042619 | Bacteria | 2809 |
| 181 | Ga0466726_407865 | 3300042619 | Bacteria | 5996 |
| 182 | Ga0466726_443895 | 3300042619 | Bacteria | 1837 |
| 183 | Ga0466726_453231 | 3300042619 | Bacteria | 23036 |
| 184 | Ga0466732_132729 | 3300042656 | Bacteria | 1206 |
| 185 | Ga0466732_165313 | 3300042656 | Unclassified | 8517 |
| 186 | Ga0123355_10002172 | 3300009826 | Bacteria | 27651 |
| 187 | Ga0123353_10120850 | 3300010167 | Unclassified | 4212 |
| 188 | Ga0123353_10256866 | 3300010167 | Bacteria | 2702 |
| 189 | AustNasuHG_c1013379 | 3300000089 | Unclassified | 2813 |
| 190 | JGI24695J34938_10004265 | 3300002450 | Bacteria | 9463 |
| 191 | JGI24695J34938_10009119 | 3300002450 | Bacteria | 5551 |
| 192 | JGI24695J34938_10032034 | 3300002450 | Bacteria | 2433 |
| 193 | Ga0102734_1002339 | 3300007129 | Bacteria | 9234 |
| 194 | Ga0102740_1000238 | 3300007140 | Bacteria | 15885 |
| 195 | Ga0466707_159112 | 3300042601 | Bacteria | 3536 |
| 196 | Ga0466707_404135 | 3300042601 | Bacteria | 1562 |
| 197 | Ga0466716_455033 | 3300042605 | Bacteria | 1300 |
| 198 | Ga0466720_048496 | 3300042607 | Bacteria | 6333 |
| 199 | Ga0456237_0000951 | 3300041968 | Bacteria | 4555 |
| 200 | Ga0466691_108014 | 3300042593 | Bacteria | 8191 |
| 201 | Ga0466696_214550 | 3300042596 | Bacteria | 1565 |
| 202 | Ga0466699_043963 | 3300042597 | Bacteria | 22179 |
| 203 | Ga0466699_404390 | 3300042597 | Bacteria | 2266 |
| 204 | Ga0466699_437613 | 3300042597 | Bacteria | 28017 |
| 205 | Ga0466734_137994 | 3300042623 | Bacteria | 2267 |
| 206 | Ga0466703_103794 | 3300042636 | Bacteria | 6558 |
| 207 | Ga0466703_180752 | 3300042636 | Bacteria | 53591 |
| 208 | Ga0466704_116062 | 3300042643 | Bacteria | 4261 |
| 209 | Ga0466704_196391 | 3300042643 | Bacteria | 1999 |
| 210 | Ga0466704_540763 | 3300042643 | Bacteria | 3213 |
| 211 | Ga0466704_591323 | 3300042643 | Unclassified | 3365 |
| 212 | Ga0466709_078962 | 3300042648 | Bacteria | 7955 |
| 213 | Ga0466709_203933 | 3300042648 | Unclassified | 3805 |
| 214 | Ga0466709_246429 | 3300042648 | Bacteria | 6953 |
| 215 | Ga0466709_247574 | 3300042648 | Unclassified | 7750 |
| 216 | Ga0466727_287120 | 3300042655 | Unclassified | 1378 |
| 217 | Ga0466715_063984 | 3300042616 | Bacteria | 3747 |
| 218 | Ga0466715_282120 | 3300042616 | Bacteria | 19105 |
| 219 | Ga0466718_135231 | 3300042617 | Bacteria | 1972 |
| 220 | Ga0466718_142718 | 3300042617 | Bacteria | 3958 |
| 221 | Ga0466726_083553 | 3300042619 | Bacteria | 12952 |
| 222 | Ga0466726_092030 | 3300042619 | Bacteria | 4971 |
| 223 | Ga0466726_328179 | 3300042619 | Bacteria | 13195 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.