Protein Family IF05989

Metagenome Isolate
160 Members
69 Samples
125 Scaffolds
375.54 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_385305|Ga0466707_385305_277_1485
Length
402 aa
Sequence
VFLEIGYTCDNYYFNNIDNVKNERKMKKRWMISLVALGILLSCGEKKEVKLTSGLEKADFVSEVAGKPTALYVLKNANGMEVCVTNYGGRIVSVMVPDKNGKLTDVVLGYDKIADYIASDGNFGALIGRYGNRIAKAKFTLNSVEYQLPENNNGNCLHGGPEGFHVQVWDAVQPDDKTLKLTYLSKDGEAGFPGNLNVTVTYSVTDNNALDIRYEATTDKLTVVNLTNHSYFNLSGIPGSQIMDHLIQINADRYTPVNELLIPTSELAPVKDTPLDLRKLIRIGDKIREPFEQMIRGRGFDHNWVLNTAGDISKPAAKAVSPESGIVLEVFTNEPGVQFYTGNAMNGKDNGKFGVNYPLRGALCLETQHYPDSPNQPTFPTTTLRPGENYLSRCIYRFSVDK

📊 Sample Types

Isolate 21.9%
Metagenome 78.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 37.7%
Kalotermitidae 20.3%
Termitidae 18.8%
Unclassified 8.7%
Rhinotermitidae 7.2%
Termopsidae 5.8%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
2 2923982719 Parabacteroides sp. 52 Isolate Blattidae
3 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
4 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
5 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
17 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
23 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
24 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
25 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
26 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
31 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
32 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
33 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
34 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
35 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
36 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
37 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
38 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
39 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
40 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
41 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
42 3004672520 Bacteroides sp. 51 Isolate Blattidae
43 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
44 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
47 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
48 3004677695 Bacteroides sp. 214 Isolate Blattidae
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
50 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
51 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
52 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
53 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
54 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
55 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
56 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
57 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
58 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
59 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
60 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
61 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
62 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
63 3004667792 Bacteroides sp. 519 Isolate Blattidae
64 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
65 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
66 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
67 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
68 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
69 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_086393 3300042659 Bacteria 29643
2 Ga0123355_10146193 3300009826 Bacteria 3604
3 Ga0072940_1007596 3300005200 Bacteria 4521
4 Ga0466704_301673 3300042643 Bacteria 8735
5 Ga0466715_444198 3300042616 Bacteria 4382
6 Ga0466690_228091 3300042590 Bacteria 31086
7 Ga0466713_001813 3300042602 Bacteria 32083
8 Ga0466713_051288 3300042602 Bacteria 230715
9 Ga0466716_409460 3300042605 Bacteria 2015
10 Ga0466705_105572 3300042612 Bacteria 4845
11 Ga0466705_381838 3300042612 Bacteria 8138
12 JGI24702J35022_10000975 3300002462 Bacteria 17901
13 JGI24702J35022_10001597 3300002462 Bacteria 14014
14 Ga0068305_10032150 3300005083 Bacteria 7165
15 Ga0466731_013692 3300042622 Bacteria 1275
16 Ga0466711_117224 3300042615 Bacteria 16870
17 Ga0466711_132062 3300042615 Bacteria 57759
18 Ga0466715_052779 3300042616 Bacteria 19691
19 Ga0466728_019784 3300042620 Bacteria 29732
20 Ga0466701_009529 3300042598 Bacteria 375690
21 Ga0466713_116260 3300042602 Bacteria 47144
22 Ga0466713_124910 3300042602 Bacteria 6378
23 Ga0466714_091791 3300042603 Bacteria 1027
24 Ga0466714_107622 3300042603 Bacteria 1831
25 Ga0466714_109427 3300042603 Bacteria 1685
26 Ga0466716_185596 3300042605 Bacteria 3119
27 Ga0466716_492338 3300042605 Bacteria 2878
28 Ga0466719_351290 3300042606 Bacteria 4406
29 Ga0466722_042520 3300042609 Bacteria 9397
30 Ga0466733_165496 3300042659 Bacteria 147790
31 Ga0123353_10000423 3300010167 Bacteria 52369
32 Ga0466704_180284 3300042643 Bacteria 2781
33 Ga0466709_144300 3300042648 Bacteria 37983
34 Ga0466711_339108 3300042615 Bacteria 40685
35 Ga0466715_074087 3300042616 Bacteria 30397
36 Ga0466715_499819 3300042616 Bacteria 11901
37 Ga0466726_116950 3300042619 Unclassified 3968
38 Ga0466691_073635 3300042593 Bacteria 11602
39 Ga0466707_098491 3300042601 Bacteria 2064
40 Ga0466705_112417 3300042612 Bacteria 33433
41 Ga0068302_10074303 3300005071 Bacteria 10727
42 Ga0466729_287263 3300042621 Bacteria 11580
43 Ga0466735_067061 3300042624 Bacteria 1901
44 Ga0466735_203667 3300042624 Bacteria 1813
45 Ga0466704_089691 3300042643 Bacteria 1865
46 Ga0466709_210619 3300042648 Bacteria 6017
47 Ga0466725_381675 3300042654 Bacteria 4035
48 Ga0466727_101685 3300042655 Bacteria 17782
49 Ga0466727_164377 3300042655 Bacteria 12250
50 Ga0466727_314491 3300042655 Bacteria 7089
51 Ga0466714_021942 3300042603 Bacteria 13165
52 Ga0466714_026440 3300042603 Bacteria 14022
53 Ga0466714_065611 3300042603 Bacteria 8303
54 Ga0466733_048400 3300042659 Bacteria 7427
55 Ga0068305_10079689 3300005083 Bacteria 3439
56 Ga0466704_041785 3300042643 Bacteria 10323
57 Ga0466704_152719 3300042643 Bacteria 1671
58 Ga0466708_119059 3300042652 Bacteria 13518
59 Ga0466711_044318 3300042615 Bacteria 25037
60 Ga0466715_442198 3300042616 Bacteria 5042
61 Ga0466690_321779 3300042590 Bacteria 7884
62 Ga0466692_180216 3300042591 Bacteria 20868
63 Ga0466691_020441 3300042593 Bacteria 5166
64 Ga0466696_025881 3300042596 Bacteria 17494
65 Ga0466706_024533 3300042599 Bacteria 13296
66 Ga0466706_094083 3300042599 Bacteria 6297
67 Ga0466707_269407 3300042601 Bacteria 19464
68 Ga0466713_045605 3300042602 Bacteria 15106
69 Ga0466722_036176 3300042609 Bacteria 3226
70 Ga0466705_068396 3300042612 Bacteria 4157
71 Ga0466733_095151 3300042659 Bacteria 7392
72 JGI24705J35276_12238724 3300002504 Bacteria 45437
73 Ga0068305_10022576 3300005083 Bacteria 24603
74 Ga0068305_10032151 3300005083 Unclassified 7493
75 Ga0466735_013034 3300042624 Bacteria 2940
76 Ga0466704_029025 3300042643 Bacteria 1755
77 Ga0466704_111454 3300042643 Unclassified 6434
78 Ga0466704_252223 3300042643 Bacteria 2243
79 Ga0466708_202391 3300042652 Bacteria 24700
80 Ga0466715_100197 3300042616 Bacteria 60516
81 Ga0466729_115252 3300042621 Bacteria 12884
82 Ga0466656_221825 3300042550 Bacteria 7605
83 Ga0466690_042411 3300042590 Bacteria 13618
84 Ga0466690_433649 3300042590 Bacteria 5754
85 Ga0466706_043135 3300042599 Bacteria 7173
86 Ga0466706_131785 3300042599 Bacteria 9596
87 Ga0466706_144992 3300042599 Bacteria 2774
88 Ga0466706_192668 3300042599 Bacteria 87404
89 Ga0466707_153234 3300042601 Bacteria 4443
90 Ga0466707_385305 3300042601 Bacteria 6191
91 Ga0466713_115244 3300042602 Bacteria 27943
92 Ga0466714_022542 3300042603 Bacteria 5094
93 Ga0466705_037118 3300042612 Bacteria 8826
94 Ga0123356_10038495 3300010049 Unclassified 4456
95 Ga0466730_094575 3300042625 Bacteria 1576
96 Ga0466703_078085 3300042636 Bacteria 3623
97 Ga0466703_241934 3300042636 Unclassified 10154
98 Ga0466704_080074 3300042643 Bacteria 18633
99 Ga0466704_377176 3300042643 Bacteria 9517
100 Ga0466709_297787 3300042648 Bacteria 33316
101 Ga0466708_398349 3300042652 Bacteria 2615
102 Ga0466711_033361 3300042615 Bacteria 49617
103 Ga0466723_138452 3300042618 Bacteria 14266
104 Ga0466726_145902 3300042619 Bacteria 4397
105 Ga0466726_370027 3300042619 Bacteria 7858
106 Ga0466692_063390 3300042591 Bacteria 95171
107 Ga0466696_133430 3300042596 Bacteria 12489
108 Ga0466706_264295 3300042599 Bacteria 25580
109 Ga0466706_276402 3300042599 Bacteria 27912
110 Ga0466722_035106 3300042609 Bacteria 44619
111 Ga0466722_244504 3300042609 Bacteria 11832
112 Ga0466705_324906 3300042612 Bacteria 3401
113 Ga0466733_184402 3300042659 Bacteria 35234
114 Ga0466730_012265 3300042625 Bacteria 13761
115 Ga0466703_062082 3300042636 Bacteria 16507
116 Ga0466725_027587 3300042654 Bacteria 14911
117 Ga0466715_268476 3300042616 Bacteria 54264
118 Ga0466728_216769 3300042620 Bacteria 9121
119 Ga0466690_060403 3300042590 Bacteria 3881
120 Ga0466706_121657 3300042599 Bacteria 7251
121 Ga0466706_238184 3300042599 Bacteria 6878
122 Ga0466707_417431 3300042601 Bacteria 2478
123 Ga0466713_109231 3300042602 Bacteria 188899
124 Ga0466719_418616 3300042606 Bacteria 1811
125 Ga0466722_046870 3300042609 Bacteria 4963

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01263 Aldose_epim Aldose 1-epimerase 71 397 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.