Protein Family IF05976
Metagenome
117
Members
36
Samples
117
Scaffolds
314.96
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_358929|Ga0466707_358929_8624_10198
- Length
- 363 aa
- Sequence
- MAKLYYAEDCDKSVLKGKTIAIIGYGSQGHAHALNLRDSGYDVIVGLYEGSKSAEAARADGFKVVTSAEAVKAADVVTILINDEKQPELYRKSVEANLRPGTTLAFAHGFNIHYGQIVPPADVDVIMIAPKGPGHTVRSQFEEGKGVPDLIAVYQNASGKAKETALAYADGIGGSRAGILETTFKEETETDLFGEQAVLCGPESAYFECVHELKLIIDLVVSQGLSFMRSSISDTAEYGDYTAGPRIITADTKKEMKKILAEIQDGTFARNWIVENQANRPSFTALRRLQSEHLINSVGDELRSKMSWKKPEPKAIPAAEPILQLPAVVEIDVPEVTRGKGKAEVIPEAPVVKQKRKYTRKAK
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.1%
Termitidae
30.6%
Rhinotermitidae
8.3%
Unclassified
8.3%
Termopsidae
8.3%
Passalidae
5.6%
Hodotermitidae
2.8%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 3 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 28 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_118691 | 3300042612 | Bacteria | 52756 |
| 2 | Ga0466726_034837 | 3300042619 | Bacteria | 2120 |
| 3 | Ga0466726_286493 | 3300042619 | Bacteria | 10263 |
| 4 | Ga0123354_10006907 | 3300010882 | Bacteria | 16951 |
| 5 | 2227466310 | 2225789004 | Bacteria | 24399 |
| 6 | IMNBL1DRAFT_c0000002 | 3300000062 | Bacteria | 288751 |
| 7 | Ga0068302_10009657 | 3300005071 | Bacteria | 15376 |
| 8 | Ga0068302_10051946 | 3300005071 | Unclassified | 1418 |
| 9 | Ga0466704_067580 | 3300042643 | Bacteria | 45946 |
| 10 | Ga0466708_122933 | 3300042652 | Bacteria | 25379 |
| 11 | Ga0466708_252856 | 3300042652 | Bacteria | 26099 |
| 12 | Ga0466708_445985 | 3300042652 | Bacteria | 17770 |
| 13 | Ga0466727_035596 | 3300042655 | Bacteria | 2019 |
| 14 | Ga0466707_411028 | 3300042601 | Bacteria | 21137 |
| 15 | Ga0466719_204996 | 3300042606 | Bacteria | 8091 |
| 16 | Ga0466705_400958 | 3300042612 | Unclassified | 2074 |
| 17 | Ga0466705_451605 | 3300042612 | Bacteria | 19411 |
| 18 | Ga0466715_634618 | 3300042616 | Bacteria | 11511 |
| 19 | Ga0123356_10011801 | 3300010049 | Bacteria | 8503 |
| 20 | Ga0123353_10061297 | 3300010167 | Bacteria | 6033 |
| 21 | 2227599624 | 2225789004 | Bacteria | 12560 |
| 22 | Ga0466729_246891 | 3300042621 | Bacteria | 5195 |
| 23 | Ga0466704_144061 | 3300042643 | Bacteria | 4285 |
| 24 | Ga0466727_103846 | 3300042655 | Bacteria | 1817 |
| 25 | Ga0466706_010193 | 3300042599 | Bacteria | 22334 |
| 26 | Ga0466706_083303 | 3300042599 | Bacteria | 1588 |
| 27 | Ga0466707_137994 | 3300042601 | Bacteria | 19785 |
| 28 | Ga0466707_367017 | 3300042601 | Bacteria | 14742 |
| 29 | Ga0466713_142722 | 3300042602 | Bacteria | 22184 |
| 30 | Ga0466722_042792 | 3300042609 | Bacteria | 8014 |
| 31 | Ga0466733_076193 | 3300042659 | Bacteria | 4567 |
| 32 | Ga0466715_001194 | 3300042616 | Bacteria | 2264 |
| 33 | Ga0466715_520933 | 3300042616 | Bacteria | 7099 |
| 34 | Ga0466726_480234 | 3300042619 | Bacteria | 8777 |
| 35 | Ga0466692_085028 | 3300042591 | Bacteria | 16287 |
| 36 | Ga0466692_127369 | 3300042591 | Bacteria | 13782 |
| 37 | Ga0123357_10090479 | 3300009784 | Bacteria | 3991 |
| 38 | Ga0123355_10120989 | 3300009826 | Bacteria | 4061 |
| 39 | Ga0123355_10286795 | 3300009826 | Bacteria | 2265 |
| 40 | Ga0123353_10030887 | 3300010167 | Bacteria | 8287 |
| 41 | 2227291912 | 2225789004 | Bacteria | 6686 |
| 42 | 2227422488 | 2225789004 | Bacteria | 5610 |
| 43 | IMNBL1DRAFT_c0002983 | 3300000062 | Unclassified | 11231 |
| 44 | Ga0466703_048712 | 3300042636 | Bacteria | 1445 |
| 45 | Ga0466703_168837 | 3300042636 | Bacteria | 1249 |
| 46 | Ga0466709_198661 | 3300042648 | Bacteria | 5821 |
| 47 | Ga0466706_215409 | 3300042599 | Bacteria | 21880 |
| 48 | Ga0466706_273183 | 3300042599 | Bacteria | 1626 |
| 49 | Ga0466719_267563 | 3300042606 | Bacteria | 1205 |
| 50 | Ga0466705_011264 | 3300042612 | Bacteria | 3393 |
| 51 | Ga0466715_173929 | 3300042616 | Bacteria | 11123 |
| 52 | Ga0466723_245637 | 3300042618 | Bacteria | 12612 |
| 53 | Ga0466696_447376 | 3300042596 | Unclassified | 3913 |
| 54 | Ga0123356_10051384 | 3300010049 | Bacteria | 3834 |
| 55 | Ga0123356_10151618 | 3300010049 | Bacteria | 2302 |
| 56 | Ga0123353_10025720 | 3300010167 | Bacteria | 8976 |
| 57 | Ga0123354_10200607 | 3300010882 | Bacteria | 2195 |
| 58 | 2227511882 | 2225789004 | Unclassified | 3535 |
| 59 | Ga0466729_272174 | 3300042621 | Bacteria | 94053 |
| 60 | Ga0466704_204690 | 3300042643 | Bacteria | 17712 |
| 61 | Ga0466706_156906 | 3300042599 | Bacteria | 4906 |
| 62 | Ga0466707_289101 | 3300042601 | Bacteria | 3334 |
| 63 | Ga0466713_077576 | 3300042602 | Bacteria | 38989 |
| 64 | Ga0466716_388194 | 3300042605 | Bacteria | 7134 |
| 65 | Ga0466719_250975 | 3300042606 | Bacteria | 7364 |
| 66 | Ga0466698_484489 | 3300042610 | Bacteria | 2951 |
| 67 | Ga0466697_131209 | 3300042611 | Bacteria | 2809 |
| 68 | Ga0466705_281951 | 3300042612 | Bacteria | 1292 |
| 69 | Ga0466711_179136 | 3300042615 | Bacteria | 3176 |
| 70 | Ga0123353_10516263 | 3300010167 | Bacteria | 1735 |
| 71 | Ga0068305_10226261 | 3300005083 | Bacteria | 2047 |
| 72 | Ga0466729_315976 | 3300042621 | Bacteria | 3525 |
| 73 | Ga0466703_024134 | 3300042636 | Bacteria | 16317 |
| 74 | Ga0466706_269567 | 3300042599 | Bacteria | 2712 |
| 75 | Ga0466700_103649 | 3300042600 | Bacteria | 1480 |
| 76 | Ga0466707_358929 | 3300042601 | Bacteria | 32027 |
| 77 | Ga0466713_103316 | 3300042602 | Bacteria | 5890 |
| 78 | Ga0466719_029393 | 3300042606 | Bacteria | 1464 |
| 79 | Ga0466719_110237 | 3300042606 | Bacteria | 1538 |
| 80 | Ga0466705_255873 | 3300042612 | Bacteria | 7464 |
| 81 | Ga0466723_074392 | 3300042618 | Bacteria | 2423 |
| 82 | Ga0466728_458103 | 3300042620 | Bacteria | 12811 |
| 83 | Ga0466692_174039 | 3300042591 | Bacteria | 10129 |
| 84 | Ga0466696_446560 | 3300042596 | Bacteria | 3891 |
| 85 | Ga0123356_10392342 | 3300010049 | Bacteria | 1523 |
| 86 | Ga0466703_397079 | 3300042636 | Unclassified | 2063 |
| 87 | Ga0466703_397603 | 3300042636 | Bacteria | 8031 |
| 88 | Ga0466700_088074 | 3300042600 | Bacteria | 2849 |
| 89 | Ga0466707_179781 | 3300042601 | Bacteria | 2901 |
| 90 | Ga0466719_287857 | 3300042606 | Bacteria | 1500 |
| 91 | Ga0466719_374081 | 3300042606 | Bacteria | 4641 |
| 92 | Ga0466728_052078 | 3300042620 | Unclassified | 8128 |
| 93 | Ga0466728_145504 | 3300042620 | Bacteria | 8085 |
| 94 | Ga0466691_003265 | 3300042593 | Bacteria | 6210 |
| 95 | Ga0123355_10087807 | 3300009826 | Bacteria | 4941 |
| 96 | IMNBL1DRAFT_c0000006 | 3300000062 | Bacteria | 247403 |
| 97 | JGI24695J34938_10007735 | 3300002450 | Bacteria | 6230 |
| 98 | Ga0466708_290335 | 3300042652 | Bacteria | 28444 |
| 99 | Ga0466708_407221 | 3300042652 | Bacteria | 24446 |
| 100 | Ga0466706_115059 | 3300042599 | Bacteria | 12640 |
| 101 | Ga0466697_165516 | 3300042611 | Bacteria | 6085 |
| 102 | Ga0466733_163750 | 3300042659 | Bacteria | 2559 |
| 103 | Ga0466726_123576 | 3300042619 | Bacteria | 11277 |
| 104 | Ga0466728_348745 | 3300042620 | Bacteria | 2959 |
| 105 | Ga0466691_193887 | 3300042593 | Bacteria | 8713 |
| 106 | Ga0123356_10009927 | 3300010049 | Bacteria | 9374 |
| 107 | Ga0123353_10110443 | 3300010167 | Bacteria | 4430 |
| 108 | Ga0123353_10164264 | 3300010167 | Bacteria | 3531 |
| 109 | Ga0123353_10223692 | 3300010167 | Bacteria | 2940 |
| 110 | IMNBL1DRAFT_c0024741 | 3300000062 | Bacteria | 2318 |
| 111 | IMNBL1DRAFT_c0056308 | 3300000062 | Bacteria | 1206 |
| 112 | JGI24695J34938_10049023 | 3300002450 | Unclassified | 1858 |
| 113 | Ga0123357_10000292 | 3300009784 | Bacteria | 47972 |
| 114 | Ga0466727_086812 | 3300042655 | Unclassified | 13897 |
| 115 | Ga0466706_144722 | 3300042599 | Bacteria | 12198 |
| 116 | Ga0466707_094949 | 3300042601 | Bacteria | 2070 |
| 117 | Ga0466714_057768 | 3300042603 | Bacteria | 2995 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07991 | IlvN | Acetohydroxy acid isomeroreductase, NADPH-binding domain | 14 | 178 | 0.99 |
| PF01450 | IlvC | Acetohydroxy acid isomeroreductase, catalytic domain | 202 | 308 | 0.99 |
| PF00670 | AdoHcyase_NAD | S-adenosyl-L-homocysteine hydrolase, NAD binding domain | 13 | 78 | 0.87 |
| PF03446 | NAD_binding_2 | NAD binding domain of 6-phosphogluconate dehydrogenase | 19 | 104 | 0.85 |
| PF03807 | F420_oxidored | NADP oxidoreductase coenzyme F420-dependent | 19 | 93 | 0.84 |
| PF02826 | 2-Hacid_dh_C | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain | 13 | 85 | 0.82 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03446 | GO:0050661 | NADP binding | MF |
| PF02826 | GO:0051287 | NAD binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.