Protein Family IF05946
Metagenome
Isolate
305
Members
90
Samples
266
Scaffolds
361.49
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_291747|Ga0466707_291747_3156_4352
- Length
- 398 aa
- Sequence
- VGSGSVDGEGGAGDCENCGVSSYLKNPYLCVKIKKQIMKKTPFNHIHHALSAKMHEFAGYDMPIEYSGIIDEHNTVVNGVGVFDVSHMGEFWIKGPKAFDLVQKITSNDVAVVPVGKVQYTCFPNDKGGIVDDLLVYHYELEKYMLVVNAANLEKDWNWCVKNNTEGAELENASDNMAQLAVQGPLALKTLQKLTDIDLTQVPYYTFVTGKIAGVDQVIISNTGYTGCGGFELYFYPEYAEKIWKAIFEAGAEFGIKPIGLGARDTLRLEAGFPLYGNELSDTTSPLQAGLGWITKFTEGNNFISRPILEAEKAKGISPQLIGFEMVSKGIARHGYEIVNQTGEVIGEVTSGTMSPYSKKAIGFGYVKVDYATLGTPIFIRIREKNIEAVVVKPPFRR
Sample Types
Isolate
12.8%
Metagenome
87.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
34.4%
Termitidae
25.6%
Kalotermitidae
15.6%
Unclassified
10.0%
Rhinotermitidae
5.6%
Termopsidae
4.4%
Passalidae
3.3%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
299
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 2 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 3 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 4 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 5 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 6 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 11 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 12 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 23 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 24 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 25 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 26 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 27 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 28 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 29 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 30 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 31 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 32 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 33 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 34 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 35 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 36 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 37 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 38 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 39 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 40 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 46 | 2828505942 | Spirobacillus cienkowskii binning01 | Isolate | Unclassified |
| 47 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 48 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 49 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 50 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 51 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 55 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 56 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 57 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 58 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 59 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 60 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 61 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 62 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 63 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 64 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 65 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 66 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 67 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 68 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 69 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 70 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 71 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 72 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 73 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 74 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 75 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 76 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 77 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 78 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 79 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 80 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 81 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 82 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 83 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 84 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 85 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 86 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 87 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 88 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 89 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 90 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_166511 | 3300042599 | Bacteria | 2137 |
| 2 | Ga0466707_389904 | 3300042601 | Bacteria | 1082 |
| 3 | Ga0466713_026988 | 3300042602 | Bacteria | 3510 |
| 4 | Ga0466716_082230 | 3300042605 | Bacteria | 10716 |
| 5 | Ga0466722_145707 | 3300042609 | Bacteria | 6799 |
| 6 | Ga0466705_478844 | 3300042612 | Bacteria | 2078 |
| 7 | Ga0466723_287921 | 3300042618 | Bacteria | 3787 |
| 8 | Ga0466726_012513 | 3300042619 | Bacteria | 3754 |
| 9 | Ga0123357_10092813 | 3300009784 | Unclassified | 3926 |
| 10 | Ga0123357_10246855 | 3300009784 | Bacteria | 1920 |
| 11 | Ga0123357_10296813 | 3300009784 | Bacteria | 1640 |
| 12 | Ga0123356_10077345 | 3300010049 | Bacteria | 3138 |
| 13 | Ga0123353_10016799 | 3300010167 | Bacteria | 10717 |
| 14 | Ga0123353_10062713 | 3300010167 | Bacteria | 5962 |
| 15 | Ga0466697_124540 | 3300042611 | Bacteria | 1301 |
| 16 | Ga0466705_041946 | 3300042612 | Bacteria | 31372 |
| 17 | Ga0466705_087709 | 3300042612 | Bacteria | 2275 |
| 18 | Ga0466705_238364 | 3300042612 | Bacteria | 7508 |
| 19 | Ga0466735_209672 | 3300042624 | Bacteria | 5763 |
| 20 | Ga0466703_013171 | 3300042636 | Bacteria | 6187 |
| 21 | Ga0466704_285273 | 3300042643 | Bacteria | 15537 |
| 22 | Ga0466724_51128 | 3300042649 | Bacteria | 2907 |
| 23 | Ga0466708_298661 | 3300042652 | Bacteria | 23088 |
| 24 | Ga0466696_011963 | 3300042596 | Bacteria | 3373 |
| 25 | Ga0466696_048088 | 3300042596 | Bacteria | 9133 |
| 26 | IMNBL1DRAFT_c0000269 | 3300000062 | Bacteria | 45968 |
| 27 | Ga0068302_10072123 | 3300005071 | Bacteria | 3260 |
| 28 | Ga0068302_10152286 | 3300005071 | Bacteria | 2556 |
| 29 | Ga0466706_128755 | 3300042599 | Bacteria | 22390 |
| 30 | Ga0466713_061337 | 3300042602 | Bacteria | 1570 |
| 31 | Ga0466713_085699 | 3300042602 | Bacteria | 4533 |
| 32 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 33 | Ga0466714_030336 | 3300042603 | Bacteria | 62156 |
| 34 | Ga0466716_163238 | 3300042605 | Bacteria | 17359 |
| 35 | Ga0466716_465856 | 3300042605 | Bacteria | 16847 |
| 36 | Ga0466719_382724 | 3300042606 | Bacteria | 5906 |
| 37 | Ga0466722_204726 | 3300042609 | Bacteria | 4754 |
| 38 | Ga0466723_027754 | 3300042618 | Bacteria | 19489 |
| 39 | Ga0466735_090353 | 3300042624 | Bacteria | 2345 |
| 40 | Ga0466735_123192 | 3300042624 | Bacteria | 41576 |
| 41 | Ga0466703_101436 | 3300042636 | Bacteria | 2724 |
| 42 | Ga0466703_428716 | 3300042636 | Bacteria | 4490 |
| 43 | Ga0466727_305463 | 3300042655 | Bacteria | 4816 |
| 44 | Ga0466690_035376 | 3300042590 | Bacteria | 20688 |
| 45 | Ga0466690_169422 | 3300042590 | Bacteria | 39612 |
| 46 | Ga0466690_362198 | 3300042590 | Bacteria | 15400 |
| 47 | Ga0466692_014052 | 3300042591 | Bacteria | 19449 |
| 48 | Ga0466692_145833 | 3300042591 | Bacteria | 11490 |
| 49 | Ga0466695_295667 | 3300042595 | Bacteria | 1404 |
| 50 | Ga0466696_053167 | 3300042596 | Bacteria | 1712 |
| 51 | Ga0466696_293482 | 3300042596 | Bacteria | 2445 |
| 52 | Ga0466701_011214 | 3300042598 | Bacteria | 11317 |
| 53 | Ga0466733_080200 | 3300042659 | Bacteria | 17486 |
| 54 | 2226980367 | 2225789003 | Bacteria | 36429 |
| 55 | IMNBL1DRAFT_c0018028 | 3300000062 | Bacteria | 2947 |
| 56 | Ga0068302_10059075 | 3300005071 | Bacteria | 4948 |
| 57 | Ga0068302_10125651 | 3300005071 | Bacteria | 4694 |
| 58 | Ga0466707_192365 | 3300042601 | Bacteria | 16028 |
| 59 | Ga0466707_291747 | 3300042601 | Bacteria | 8447 |
| 60 | Ga0466713_036716 | 3300042602 | Bacteria | 8916 |
| 61 | Ga0466713_076628 | 3300042602 | Bacteria | 27834 |
| 62 | Ga0466716_015031 | 3300042605 | Bacteria | 4791 |
| 63 | Ga0466722_256526 | 3300042609 | Bacteria | 1777 |
| 64 | Ga0466710_076305 | 3300042613 | Bacteria | 7488 |
| 65 | Ga0466710_141978 | 3300042613 | Bacteria | 1475 |
| 66 | Ga0466711_155686 | 3300042615 | Bacteria | 35611 |
| 67 | Ga0466711_393024 | 3300042615 | Bacteria | 7757 |
| 68 | Ga0466715_416562 | 3300042616 | Bacteria | 10652 |
| 69 | Ga0466715_477429 | 3300042616 | Bacteria | 1696 |
| 70 | Ga0466726_480399 | 3300042619 | Bacteria | 3283 |
| 71 | Ga0466728_386665 | 3300042620 | Bacteria | 55152 |
| 72 | Ga0123357_10005087 | 3300009784 | Bacteria | 15664 |
| 73 | Ga0123357_10197553 | 3300009784 | Unclassified | 2299 |
| 74 | Ga0123356_10087387 | 3300010049 | Bacteria | 2961 |
| 75 | Ga0123354_10020393 | 3300010882 | Bacteria | 10427 |
| 76 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 77 | Ga0466734_062461 | 3300042623 | Bacteria | 2860 |
| 78 | Ga0466735_020598 | 3300042624 | Bacteria | 7328 |
| 79 | Ga0466735_157851 | 3300042624 | Bacteria | 11142 |
| 80 | Ga0466703_279486 | 3300042636 | Bacteria | 16934 |
| 81 | Ga0466704_133327 | 3300042643 | Bacteria | 5342 |
| 82 | Ga0466704_206049 | 3300042643 | Bacteria | 14559 |
| 83 | Ga0466704_439022 | 3300042643 | Bacteria | 9301 |
| 84 | Ga0466709_216670 | 3300042648 | Bacteria | 31600 |
| 85 | Ga0466709_386937 | 3300042648 | Bacteria | 2104 |
| 86 | Ga0466727_285546 | 3300042655 | Bacteria | 2148 |
| 87 | Ga0466657_217982 | 3300042582 | Bacteria | 10357 |
| 88 | Ga0466692_014788 | 3300042591 | Bacteria | 8224 |
| 89 | Ga0466692_119633 | 3300042591 | Bacteria | 108688 |
| 90 | Ga0466691_023015 | 3300042593 | Bacteria | 13261 |
| 91 | Ga0466695_200488 | 3300042595 | Bacteria | 1860 |
| 92 | Ga0466733_090502 | 3300042659 | Bacteria | 1503 |
| 93 | Ga0466733_095609 | 3300042659 | Bacteria | 1181 |
| 94 | IMNBL1DRAFT_c0002309 | 3300000062 | Bacteria | 13385 |
| 95 | Ga0466706_143353 | 3300042599 | Bacteria | 3717 |
| 96 | Ga0466700_013591 | 3300042600 | Bacteria | 2273 |
| 97 | Ga0466707_242090 | 3300042601 | Bacteria | 13004 |
| 98 | Ga0466707_354121 | 3300042601 | Bacteria | 17457 |
| 99 | Ga0466711_169445 | 3300042615 | Bacteria | 6781 |
| 100 | Ga0466715_152539 | 3300042616 | Bacteria | 13923 |
| 101 | Ga0466715_167878 | 3300042616 | Bacteria | 7282 |
| 102 | Ga0466715_188075 | 3300042616 | Bacteria | 87062 |
| 103 | Ga0466715_327431 | 3300042616 | Bacteria | 11649 |
| 104 | Ga0466715_615987 | 3300042616 | Bacteria | 3660 |
| 105 | Ga0466726_241421 | 3300042619 | Bacteria | 8967 |
| 106 | Ga0466728_289611 | 3300042620 | Bacteria | 33319 |
| 107 | Ga0123356_10010507 | 3300010049 | Bacteria | 9080 |
| 108 | Ga0123356_10272945 | 3300010049 | Bacteria | 1782 |
| 109 | Ga0123354_10323217 | 3300010882 | Bacteria | 1420 |
| 110 | Ga0466697_232680 | 3300042611 | Bacteria | 3580 |
| 111 | Ga0466734_116526 | 3300042623 | Bacteria | 1118 |
| 112 | Ga0466735_089230 | 3300042624 | Bacteria | 8319 |
| 113 | Ga0466703_070399 | 3300042636 | Bacteria | 12953 |
| 114 | Ga0466703_331928 | 3300042636 | Bacteria | 15818 |
| 115 | Ga0466704_082791 | 3300042643 | Bacteria | 24873 |
| 116 | Ga0466704_259108 | 3300042643 | Bacteria | 4835 |
| 117 | Ga0466704_335482 | 3300042643 | Bacteria | 5231 |
| 118 | Ga0466704_511298 | 3300042643 | Bacteria | 1671 |
| 119 | Ga0466725_435819 | 3300042654 | Bacteria | 6332 |
| 120 | Ga0466727_059599 | 3300042655 | Bacteria | 19217 |
| 121 | Ga0466727_087603 | 3300042655 | Bacteria | 3601 |
| 122 | Ga0466727_257128 | 3300042655 | Bacteria | 4803 |
| 123 | Ga0466690_026402 | 3300042590 | Bacteria | 15626 |
| 124 | Ga0466690_370248 | 3300042590 | Bacteria | 2873 |
| 125 | Ga0466692_057251 | 3300042591 | Bacteria | 14769 |
| 126 | Ga0466694_305862 | 3300042594 | Bacteria | 1425 |
| 127 | Ga0466696_150388 | 3300042596 | Bacteria | 6832 |
| 128 | Ga0466696_179297 | 3300042596 | Bacteria | 26500 |
| 129 | Ga0466733_113182 | 3300042659 | Bacteria | 23316 |
| 130 | 2227083904 | 2225789004 | Bacteria | 1866 |
| 131 | 2227482985 | 2225789004 | Bacteria | 21532 |
| 132 | 2227555474 | 2225789004 | Bacteria | 2794 |
| 133 | 2227644039 | 2225789004 | Bacteria | 11035 |
| 134 | JGI24702J35022_10011972 | 3300002462 | Bacteria | 4831 |
| 135 | JGI24702J35022_10041236 | 3300002462 | Bacteria | 2461 |
| 136 | JGI24699J35502_11134023 | 3300002509 | Bacteria | 24833 |
| 137 | JGI24696J40584_12948987 | 3300002834 | Bacteria | 2042 |
| 138 | Ga0466706_077892 | 3300042599 | Bacteria | 3208 |
| 139 | Ga0466700_047234 | 3300042600 | Bacteria | 31011 |
| 140 | Ga0466713_011700 | 3300042602 | Bacteria | 2647 |
| 141 | Ga0466716_242397 | 3300042605 | Bacteria | 12768 |
| 142 | Ga0466719_176141 | 3300042606 | Bacteria | 20840 |
| 143 | Ga0466719_508543 | 3300042606 | Bacteria | 4973 |
| 144 | Ga0466722_103200 | 3300042609 | Bacteria | 5895 |
| 145 | Ga0466705_418122 | 3300042612 | Unclassified | 2818 |
| 146 | Ga0466715_291316 | 3300042616 | Bacteria | 9506 |
| 147 | Ga0123357_10008862 | 3300009784 | Bacteria | 12632 |
| 148 | Ga0123357_10104108 | 3300009784 | Unclassified | 3646 |
| 149 | Ga0466735_049594 | 3300042624 | Bacteria | 10942 |
| 150 | Ga0466703_082017 | 3300042636 | Bacteria | 5765 |
| 151 | Ga0466703_212754 | 3300042636 | Bacteria | 16986 |
| 152 | Ga0466704_112671 | 3300042643 | Bacteria | 16257 |
| 153 | Ga0466704_316617 | 3300042643 | Bacteria | 11718 |
| 154 | Ga0466704_510672 | 3300042643 | Bacteria | 1671 |
| 155 | Ga0466709_259730 | 3300042648 | Bacteria | 1393 |
| 156 | Ga0466708_349638 | 3300042652 | Bacteria | 47516 |
| 157 | Ga0466725_066104 | 3300042654 | Bacteria | 1716 |
| 158 | Ga0466725_430523 | 3300042654 | Bacteria | 1823 |
| 159 | Ga0466691_024824 | 3300042593 | Bacteria | 35368 |
| 160 | Ga0466691_029235 | 3300042593 | Bacteria | 3291 |
| 161 | Ga0466691_030684 | 3300042593 | Bacteria | 9077 |
| 162 | Ga0466691_130230 | 3300042593 | Bacteria | 3148 |
| 163 | Ga0466696_037791 | 3300042596 | Bacteria | 6552 |
| 164 | Ga0466701_074878 | 3300042598 | Bacteria | 1549 |
| 165 | Ga0466706_023002 | 3300042599 | Bacteria | 18325 |
| 166 | Ga0466706_116889 | 3300042599 | Bacteria | 24165 |
| 167 | Ga0466706_144313 | 3300042599 | Unclassified | 13805 |
| 168 | Ga0466707_386725 | 3300042601 | Bacteria | 3112 |
| 169 | Ga0466713_001029 | 3300042602 | Bacteria | 24080 |
| 170 | Ga0466713_013757 | 3300042602 | Bacteria | 111029 |
| 171 | Ga0466713_071505 | 3300042602 | Bacteria | 34437 |
| 172 | Ga0466713_118645 | 3300042602 | Bacteria | 113373 |
| 173 | Ga0466719_143847 | 3300042606 | Bacteria | 15783 |
| 174 | Ga0466722_041417 | 3300042609 | Bacteria | 5978 |
| 175 | Ga0466722_222929 | 3300042609 | Bacteria | 2942 |
| 176 | Ga0466722_231121 | 3300042609 | Bacteria | 6011 |
| 177 | Ga0466710_132039 | 3300042613 | Bacteria | 2040 |
| 178 | Ga0466715_046914 | 3300042616 | Bacteria | 6810 |
| 179 | Ga0466715_057287 | 3300042616 | Bacteria | 64422 |
| 180 | Ga0466715_310592 | 3300042616 | Bacteria | 22582 |
| 181 | Ga0466723_058187 | 3300042618 | Bacteria | 3167 |
| 182 | Ga0466723_080334 | 3300042618 | Bacteria | 4130 |
| 183 | Ga0466726_018486 | 3300042619 | Bacteria | 2837 |
| 184 | Ga0466728_416711 | 3300042620 | Bacteria | 4909 |
| 185 | Ga0466729_009389 | 3300042621 | Bacteria | 3280 |
| 186 | Ga0123357_10234064 | 3300009784 | Bacteria | 2005 |
| 187 | Ga0123354_10002881 | 3300010882 | Bacteria | 23311 |
| 188 | Ga0123354_10093482 | 3300010882 | Bacteria | 4133 |
| 189 | Ga0466705_099969 | 3300042612 | Bacteria | 49190 |
| 190 | Ga0466705_112896 | 3300042612 | Bacteria | 6237 |
| 191 | Ga0466705_317163 | 3300042612 | Bacteria | 6069 |
| 192 | Ga0466735_161992 | 3300042624 | Bacteria | 2961 |
| 193 | Ga0466703_286961 | 3300042636 | Bacteria | 18817 |
| 194 | Ga0466704_048628 | 3300042643 | Bacteria | 23528 |
| 195 | Ga0466704_250849 | 3300042643 | Bacteria | 3158 |
| 196 | Ga0466704_515630 | 3300042643 | Bacteria | 2968 |
| 197 | Ga0466709_358536 | 3300042648 | Bacteria | 3181 |
| 198 | Ga0466708_231633 | 3300042652 | Bacteria | 19062 |
| 199 | Ga0466708_373102 | 3300042652 | Bacteria | 35091 |
| 200 | Ga0466727_065764 | 3300042655 | Bacteria | 7001 |
| 201 | Ga0466727_073949 | 3300042655 | Bacteria | 13665 |
| 202 | Ga0466690_003893 | 3300042590 | Bacteria | 7694 |
| 203 | Ga0466692_065364 | 3300042591 | Bacteria | 1485 |
| 204 | IMNBL1DRAFT_c0000374 | 3300000062 | Bacteria | 38245 |
| 205 | IMNBL1DRAFT_c0001325 | 3300000062 | Bacteria | 18622 |
| 206 | JGI24699J35502_11134095 | 3300002509 | Bacteria | 30132 |
| 207 | Ga0466706_192668 | 3300042599 | Bacteria | 87404 |
| 208 | Ga0466713_087963 | 3300042602 | Bacteria | 29681 |
| 209 | Ga0466713_088602 | 3300042602 | Bacteria | 7249 |
| 210 | Ga0466716_367415 | 3300042605 | Bacteria | 3408 |
| 211 | Ga0466722_084845 | 3300042609 | Bacteria | 12856 |
| 212 | Ga0466722_103295 | 3300042609 | Bacteria | 13623 |
| 213 | Ga0466722_246977 | 3300042609 | Bacteria | 20576 |
| 214 | Ga0466711_192864 | 3300042615 | Bacteria | 2656 |
| 215 | Ga0466726_464631 | 3300042619 | Unclassified | 4010 |
| 216 | Ga0466728_092204 | 3300042620 | Bacteria | 8518 |
| 217 | Ga0123354_10306225 | 3300010882 | Bacteria | 1493 |
| 218 | Ga0466734_136293 | 3300042623 | Bacteria | 1755 |
| 219 | Ga0466704_199953 | 3300042643 | Bacteria | 14178 |
| 220 | Ga0466708_053876 | 3300042652 | Bacteria | 7471 |
| 221 | Ga0466725_269927 | 3300042654 | Bacteria | 4308 |
| 222 | Ga0466696_267794 | 3300042596 | Bacteria | 6801 |
| 223 | Ga0466733_067391 | 3300042659 | Bacteria | 15656 |
| 224 | Ga0466733_137845 | 3300042659 | Bacteria | 3132 |
| 225 | Ga0466733_214516 | 3300042659 | Bacteria | 5976 |
| 226 | IMNBL1DRAFT_c0007838 | 3300000062 | Bacteria | 5540 |
| 227 | IMNBL1DRAFT_c0019167 | 3300000062 | Bacteria | 2813 |
| 228 | IMNBL1DRAFT_c0022580 | 3300000062 | Bacteria | 2486 |
| 229 | JGI24705J35276_12236848 | 3300002504 | Bacteria | 9083 |
| 230 | JGI24699J35502_11134201 | 3300002509 | Bacteria | 54341 |
| 231 | Ga0466707_048963 | 3300042601 | Bacteria | 13945 |
| 232 | Ga0466713_030484 | 3300042602 | Bacteria | 5409 |
| 233 | Ga0466717_123757 | 3300042604 | Bacteria | 2226 |
| 234 | Ga0466716_304356 | 3300042605 | Bacteria | 13356 |
| 235 | Ga0466719_170309 | 3300042606 | Bacteria | 9587 |
| 236 | Ga0466719_227500 | 3300042606 | Bacteria | 5336 |
| 237 | Ga0466698_312504 | 3300042610 | Bacteria | 2654 |
| 238 | Ga0466705_402722 | 3300042612 | Bacteria | 5078 |
| 239 | Ga0466710_045336 | 3300042613 | Bacteria | 3698 |
| 240 | Ga0466710_138672 | 3300042613 | Bacteria | 7277 |
| 241 | Ga0466710_438802 | 3300042613 | Bacteria | 1950 |
| 242 | Ga0466711_080827 | 3300042615 | Bacteria | 6794 |
| 243 | Ga0466711_184071 | 3300042615 | Bacteria | 34370 |
| 244 | Ga0466711_420446 | 3300042615 | Bacteria | 8654 |
| 245 | Ga0466715_091894 | 3300042616 | Bacteria | 14782 |
| 246 | Ga0466726_288688 | 3300042619 | Bacteria | 30753 |
| 247 | Ga0466728_095110 | 3300042620 | Bacteria | 4182 |
| 248 | Ga0123357_10022026 | 3300009784 | Bacteria | 8537 |
| 249 | Ga0123355_10019240 | 3300009826 | Bacteria | 10867 |
| 250 | Ga0123353_10013757 | 3300010167 | Bacteria | 11608 |
| 251 | Ga0123353_10550157 | 3300010167 | Bacteria | 1665 |
| 252 | Ga0466705_138059 | 3300042612 | Bacteria | 2190 |
| 253 | Ga0466705_150716 | 3300042612 | Bacteria | 5349 |
| 254 | Ga0466703_052235 | 3300042636 | Bacteria | 3370 |
| 255 | Ga0466703_249135 | 3300042636 | Bacteria | 31792 |
| 256 | Ga0466703_334538 | 3300042636 | Bacteria | 14199 |
| 257 | Ga0466703_400896 | 3300042636 | Bacteria | 22375 |
| 258 | Ga0466727_203123 | 3300042655 | Bacteria | 7870 |
| 259 | Ga0466692_016024 | 3300042591 | Bacteria | 10962 |
| 260 | Ga0466696_049384 | 3300042596 | Bacteria | 5190 |
| 261 | Ga0466733_106246 | 3300042659 | Bacteria | 308825 |
| 262 | Ga0466733_216697 | 3300042659 | Bacteria | 189231 |
| 263 | 2227116927 | 2225789004 | Bacteria | 9259 |
| 264 | IMNBL1DRAFT_c0004623 | 3300000062 | Bacteria | 8187 |
| 265 | Ga0068305_10003714 | 3300005083 | Bacteria | 240854 |
| 266 | Ga0068305_10034187 | 3300005083 | Bacteria | 4732 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.