Protein Family IF05920
Metagenome
Isolate
329
Members
88
Samples
296
Scaffolds
288.42
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_253648|Ga0466707_253648_19360_20328
- Length
- 322 aa
- Sequence
- MIFTAGNLLPKPLARAPPCTAEKAELRQSTMHFKEAKGILSAANGMNISRGCIHGCIYCDARSKCYNMDHVFEDVEIKSNAPQLLEQALKRKRKKCMIGTGAMSDPYIPIPENLSNIRTCLELIEKYGCGLAIQTKSNLILQDLDLLIKINNKAKCIVEITLTTFDEDLCKIIEPNVSTTKERFEILKTMRDNEIQTIVWLSPILPFINDTEENIRGILRYCTEAKVYGIICFEMGMTLREGDREYFYQNLDKHFPDLKRKYQSKYGNNYILTSDYNKPLMQIFYETCRENNIVYGNDALFDYMHTFEAKHTAGQLSLFDSC
Sample Types
Isolate
10.0%
Metagenome
90.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.5%
Unclassified
32.6%
Kalotermitidae
15.1%
Termopsidae
4.7%
Passalidae
2.3%
Rhinotermitidae
2.3%
Blattidae
1.2%
Stratiomyidae
1.2%
Hodotermitidae
1.2%
Taxonomy
Archaea
5
Bacteria
308
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 3 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 4 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 5 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 6 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 7 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 13 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 14 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 15 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 16 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 36 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 37 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 38 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 43 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 44 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 45 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 46 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 47 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 48 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 49 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 55 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 58 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 59 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 60 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 61 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 62 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 63 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 64 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 65 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 66 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 67 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 68 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 69 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 70 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 71 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 72 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 73 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 74 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 75 | 2820348946 | Unclassified Firmicutes Nt197P3bin47 | Isolate | Unclassified |
| 76 | 2773857689 | Unclassified Methanomassiliicoccaceae Nt197P3bin8 | Isolate | Unclassified |
| 77 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 78 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 79 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 80 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 81 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 82 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 83 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 84 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 85 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 86 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 87 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 88 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_208346 | 3300042611 | Bacteria | 1019 |
| 2 | Ga0415639_006687 | 3300038395 | Bacteria | 24166 |
| 3 | Ga0466693_110860 | 3300042592 | Unclassified | 2561 |
| 4 | Ga0466701_000215 | 3300042598 | Bacteria | 1238 |
| 5 | 2227080767 | 2225789004 | Bacteria | 312922 |
| 6 | 2227080788 | 2225789004 | Bacteria | 142057 |
| 7 | AustNasuHG_c1002501 | 3300000089 | Bacteria | 6655 |
| 8 | JGI24698J34947_10004230 | 3300002449 | Bacteria | 7804 |
| 9 | JGI24698J34947_10019931 | 3300002449 | Bacteria | 3614 |
| 10 | JGI24698J34947_10103962 | 3300002449 | Bacteria | 1269 |
| 11 | JGI24695J34938_10000527 | 3300002450 | Bacteria | 37190 |
| 12 | JGI24695J34938_10003035 | 3300002450 | Bacteria | 12043 |
| 13 | JGI24695J34938_10003111 | 3300002450 | Bacteria | 11845 |
| 14 | JGI24695J34938_10026266 | 3300002450 | Bacteria | 2769 |
| 15 | Ga0072941_1006214 | 3300005201 | Bacteria | 26024 |
| 16 | Ga0072941_1088374 | 3300005201 | Bacteria | 6748 |
| 17 | Ga0466712_122598 | 3300042614 | Bacteria | 1082 |
| 18 | Ga0466712_321462 | 3300042614 | Bacteria | 3574 |
| 19 | Ga0466711_310118 | 3300042615 | Unclassified | 1303 |
| 20 | Ga0466718_001108 | 3300042617 | Bacteria | 14430 |
| 21 | Ga0466707_360041 | 3300042601 | Bacteria | 22865 |
| 22 | Ga0466717_000201 | 3300042604 | Bacteria | 1770 |
| 23 | Ga0466717_149817 | 3300042604 | Bacteria | 1836 |
| 24 | Ga0466719_027453 | 3300042606 | Bacteria | 5859 |
| 25 | Ga0466720_062292 | 3300042607 | Bacteria | 1223 |
| 26 | Ga0466735_060482 | 3300042624 | Bacteria | 1444 |
| 27 | Ga0466735_128550 | 3300042624 | Bacteria | 1133 |
| 28 | Ga0466735_203259 | 3300042624 | Bacteria | 4181 |
| 29 | Ga0123356_10011085 | 3300010049 | Bacteria | 8803 |
| 30 | Ga0123356_10015858 | 3300010049 | Bacteria | 7211 |
| 31 | Ga0123356_10249451 | 3300010049 | Bacteria | 1852 |
| 32 | Ga0123353_10140014 | 3300010167 | Bacteria | 3876 |
| 33 | Ga0123353_10708298 | 3300010167 | Unclassified | 1411 |
| 34 | Ga0466705_189713 | 3300042612 | Bacteria | 5580 |
| 35 | Ga0466732_089946 | 3300042656 | Bacteria | 1477 |
| 36 | Ga0466732_342540 | 3300042656 | Bacteria | 1815 |
| 37 | Ga0466733_027003 | 3300042659 | Bacteria | 1105 |
| 38 | Ga0264413_146295 | 3300024493 | Bacteria | 1101 |
| 39 | Ga0415639_006772 | 3300038395 | Bacteria | 44751 |
| 40 | Ga0466695_375628 | 3300042595 | Bacteria | 7485 |
| 41 | Ga0466699_096540 | 3300042597 | Bacteria | 18873 |
| 42 | Ga0466699_149212 | 3300042597 | Bacteria | 34863 |
| 43 | Ga0466699_274342 | 3300042597 | Bacteria | 13029 |
| 44 | JGI24698J34947_10024094 | 3300002449 | Bacteria | 3251 |
| 45 | JGI24695J34938_10000092 | 3300002450 | Bacteria | 78528 |
| 46 | JGI24695J34938_10000413 | 3300002450 | Bacteria | 41558 |
| 47 | Ga0072941_1017882 | 3300005201 | Bacteria | 7396 |
| 48 | Ga0466712_045670 | 3300042614 | Bacteria | 5484 |
| 49 | Ga0466712_060461 | 3300042614 | Bacteria | 8499 |
| 50 | Ga0466712_187414 | 3300042614 | Bacteria | 2750 |
| 51 | Ga0466712_263116 | 3300042614 | Bacteria | 1652 |
| 52 | Ga0466718_105204 | 3300042617 | Bacteria | 13922 |
| 53 | Ga0466726_003524 | 3300042619 | Bacteria | 4622 |
| 54 | Ga0466726_482701 | 3300042619 | Archaea | 1634 |
| 55 | Ga0466700_048130 | 3300042600 | Bacteria | 3366 |
| 56 | Ga0466714_073435 | 3300042603 | Bacteria | 65549 |
| 57 | Ga0466716_147475 | 3300042605 | Bacteria | 1161 |
| 58 | Ga0466720_021667 | 3300042607 | Bacteria | 4296 |
| 59 | Ga0466720_022631 | 3300042607 | Bacteria | 3983 |
| 60 | Ga0466722_105440 | 3300042609 | Bacteria | 1841 |
| 61 | Ga0466698_013692 | 3300042610 | Unclassified | 1877 |
| 62 | Ga0466703_299162 | 3300042636 | Bacteria | 1188 |
| 63 | Ga0466709_150547 | 3300042648 | Bacteria | 1784 |
| 64 | Ga0466727_141121 | 3300042655 | Bacteria | 1299 |
| 65 | Ga0123355_10001367 | 3300009826 | Bacteria | 33953 |
| 66 | Ga0123356_10011545 | 3300010049 | Bacteria | 8606 |
| 67 | Ga0123356_10038486 | 3300010049 | Bacteria | 4457 |
| 68 | Ga0123356_10611808 | 3300010049 | Bacteria | 1255 |
| 69 | Ga0123353_10388286 | 3300010167 | Unclassified | 2084 |
| 70 | Ga0466694_046714 | 3300042594 | Bacteria | 1390 |
| 71 | Ga0466695_178889 | 3300042595 | Bacteria | 70582 |
| 72 | Ga0466699_013495 | 3300042597 | Bacteria | 44428 |
| 73 | IMNBL1DRAFT_c0007188 | 3300000062 | Bacteria | 5906 |
| 74 | AustNasuHG_c1000819 | 3300000089 | Bacteria | 11170 |
| 75 | AustNasuHG_c1000894 | 3300000089 | Bacteria | 10770 |
| 76 | JGI24698J34947_10023900 | 3300002449 | Bacteria | 3266 |
| 77 | JGI24695J34938_10000327 | 3300002450 | Bacteria | 46825 |
| 78 | JGI24695J34938_10021938 | 3300002450 | Bacteria | 3112 |
| 79 | JGI24702J35022_10000798 | 3300002462 | Bacteria | 19487 |
| 80 | JGI24702J35022_10004772 | 3300002462 | Unclassified | 8008 |
| 81 | JGI24705J35276_12216540 | 3300002504 | Archaea | 2051 |
| 82 | Ga0068302_10438504 | 3300005071 | Bacteria | 3788 |
| 83 | Ga0466712_048180 | 3300042614 | Bacteria | 28929 |
| 84 | Ga0466712_056486 | 3300042614 | Bacteria | 6014 |
| 85 | Ga0466712_156309 | 3300042614 | Bacteria | 11194 |
| 86 | Ga0466711_248898 | 3300042615 | Bacteria | 1491 |
| 87 | Ga0466723_111450 | 3300042618 | Bacteria | 2997 |
| 88 | Ga0466726_174945 | 3300042619 | Bacteria | 1371 |
| 89 | Ga0466729_028450 | 3300042621 | Bacteria | 1314 |
| 90 | Ga0466706_117630 | 3300042599 | Bacteria | 15050 |
| 91 | Ga0466706_282321 | 3300042599 | Bacteria | 1029 |
| 92 | Ga0466707_252715 | 3300042601 | Bacteria | 2114 |
| 93 | Ga0466707_253648 | 3300042601 | Bacteria | 23791 |
| 94 | Ga0466707_395566 | 3300042601 | Bacteria | 14223 |
| 95 | Ga0466716_239564 | 3300042605 | Bacteria | 4300 |
| 96 | Ga0466720_093361 | 3300042607 | Bacteria | 5432 |
| 97 | Ga0466720_112492 | 3300042607 | Bacteria | 10518 |
| 98 | Ga0466709_237057 | 3300042648 | Unclassified | 4070 |
| 99 | Ga0123355_10303617 | 3300009826 | Bacteria | 2172 |
| 100 | Ga0123356_10001354 | 3300010049 | Bacteria | 27067 |
| 101 | Ga0123356_10028917 | 3300010049 | Bacteria | 5194 |
| 102 | Ga0123353_10001965 | 3300010167 | Bacteria | 25350 |
| 103 | Ga0123353_10341082 | 3300010167 | Bacteria | 2263 |
| 104 | Ga0123353_10997542 | 3300010167 | Bacteria | 1125 |
| 105 | Ga0264413_106905 | 3300024493 | Bacteria | 13831 |
| 106 | Ga0466690_201568 | 3300042590 | Bacteria | 1697 |
| 107 | Ga0466694_352853 | 3300042594 | Bacteria | 7971 |
| 108 | Ga0466696_049588 | 3300042596 | Bacteria | 3390 |
| 109 | Ga0466696_201595 | 3300042596 | Bacteria | 5456 |
| 110 | Ga0466699_070146 | 3300042597 | Bacteria | 1167 |
| 111 | Ga0466699_101717 | 3300042597 | Bacteria | 1481 |
| 112 | Ga0466699_168659 | 3300042597 | Bacteria | 1714 |
| 113 | Ga0466699_172205 | 3300042597 | Bacteria | 1132 |
| 114 | AustNasuHG_c1010026 | 3300000089 | Bacteria | 3312 |
| 115 | JGI24695J34938_10000190 | 3300002450 | Bacteria | 57427 |
| 116 | JGI24695J34938_10000866 | 3300002450 | Bacteria | 27990 |
| 117 | JGI24695J34938_10002087 | 3300002450 | Bacteria | 15666 |
| 118 | JGI24695J34938_10030130 | 3300002450 | Bacteria | 2530 |
| 119 | JGI24702J35022_10004318 | 3300002462 | Bacteria | 8475 |
| 120 | JGI24705J35276_12113809 | 3300002504 | Bacteria | 1051 |
| 121 | JGI24697J35500_11274480 | 3300002507 | Bacteria | 7461 |
| 122 | JGI24696J40584_12959562 | 3300002834 | Bacteria | 5295 |
| 123 | Ga0072941_1083604 | 3300005201 | Bacteria | 3641 |
| 124 | Ga0072941_1105534 | 3300005201 | Bacteria | 1346 |
| 125 | Ga0466712_020570 | 3300042614 | Bacteria | 11052 |
| 126 | Ga0466712_022153 | 3300042614 | Bacteria | 3120 |
| 127 | Ga0466715_185647 | 3300042616 | Bacteria | 17058 |
| 128 | Ga0466718_156027 | 3300042617 | Bacteria | 1163 |
| 129 | Ga0466726_366545 | 3300042619 | Bacteria | 3431 |
| 130 | Ga0466726_426138 | 3300042619 | Bacteria | 4137 |
| 131 | Ga0466707_205396 | 3300042601 | Bacteria | 1283 |
| 132 | Ga0466707_227347 | 3300042601 | Bacteria | 2489 |
| 133 | Ga0466719_135356 | 3300042606 | Bacteria | 3235 |
| 134 | Ga0466719_512843 | 3300042606 | Bacteria | 6240 |
| 135 | Ga0466720_052117 | 3300042607 | Bacteria | 26645 |
| 136 | Ga0466722_176589 | 3300042609 | Bacteria | 32039 |
| 137 | Ga0466731_095588 | 3300042622 | Bacteria | 2258 |
| 138 | Ga0466735_170753 | 3300042624 | Bacteria | 1096 |
| 139 | Ga0466735_174552 | 3300042624 | Bacteria | 1203 |
| 140 | Ga0466702_139062 | 3300042635 | Bacteria | 1755 |
| 141 | Ga0466703_230851 | 3300042636 | Bacteria | 1546 |
| 142 | Ga0466704_497087 | 3300042643 | Bacteria | 2363 |
| 143 | Ga0466727_069805 | 3300042655 | Bacteria | 4236 |
| 144 | Ga0466727_338234 | 3300042655 | Bacteria | 1872 |
| 145 | Ga0123355_10006818 | 3300009826 | Bacteria | 16993 |
| 146 | Ga0123356_10016718 | 3300010049 | Bacteria | 6995 |
| 147 | Ga0123356_10068532 | 3300010049 | Bacteria | 3324 |
| 148 | Ga0123356_10145798 | 3300010049 | Bacteria | 2342 |
| 149 | Ga0123356_10767550 | 3300010049 | Bacteria | 1135 |
| 150 | Ga0123353_10053021 | 3300010167 | Bacteria | 6483 |
| 151 | Ga0123353_10228094 | 3300010167 | Bacteria | 2906 |
| 152 | Ga0123353_10239143 | 3300010167 | Bacteria | 2823 |
| 153 | Ga0123353_10360211 | 3300010167 | Bacteria | 2186 |
| 154 | Ga0123353_10752268 | 3300010167 | Bacteria | 1356 |
| 155 | Ga0123353_10787130 | 3300010167 | Unclassified | 1316 |
| 156 | Ga0415639_008115 | 3300038395 | Bacteria | 22250 |
| 157 | Ga0466690_209612 | 3300042590 | Bacteria | 2306 |
| 158 | Ga0466690_371610 | 3300042590 | Bacteria | 2844 |
| 159 | Ga0466699_008136 | 3300042597 | Bacteria | 3620 |
| 160 | JGI24698J34947_10008255 | 3300002449 | Bacteria | 5711 |
| 161 | JGI24698J34947_10025034 | 3300002449 | Bacteria | 3179 |
| 162 | JGI24695J34938_10003869 | 3300002450 | Bacteria | 10140 |
| 163 | JGI24695J34938_10028117 | 3300002450 | Bacteria | 2646 |
| 164 | Ga0466712_069423 | 3300042614 | Bacteria | 1921 |
| 165 | Ga0466711_506336 | 3300042615 | Bacteria | 1007 |
| 166 | Ga0466715_326881 | 3300042616 | Bacteria | 1430 |
| 167 | Ga0466718_028321 | 3300042617 | Bacteria | 7859 |
| 168 | Ga0466706_264146 | 3300042599 | Bacteria | 8413 |
| 169 | Ga0466720_023609 | 3300042607 | Bacteria | 2203 |
| 170 | Ga0466720_059176 | 3300042607 | Bacteria | 22433 |
| 171 | Ga0466720_087914 | 3300042607 | Bacteria | 2058 |
| 172 | Ga0466729_199728 | 3300042621 | Bacteria | 5202 |
| 173 | Ga0466735_004376 | 3300042624 | Bacteria | 9516 |
| 174 | Ga0466703_065478 | 3300042636 | Bacteria | 5338 |
| 175 | Ga0466704_137733 | 3300042643 | Bacteria | 10089 |
| 176 | Ga0466709_159741 | 3300042648 | Bacteria | 3595 |
| 177 | Ga0466727_238283 | 3300042655 | Bacteria | 1322 |
| 178 | Ga0466727_299806 | 3300042655 | Bacteria | 1083 |
| 179 | Ga0123356_10004396 | 3300010049 | Bacteria | 14569 |
| 180 | Ga0123356_10745116 | 3300010049 | Unclassified | 1150 |
| 181 | Ga0123353_10235497 | 3300010167 | Unclassified | 2850 |
| 182 | Ga0123354_10250007 | 3300010882 | Bacteria | 1799 |
| 183 | Ga0466705_277767 | 3300042612 | Bacteria | 5845 |
| 184 | Ga0466705_292992 | 3300042612 | Bacteria | 5733 |
| 185 | Ga0466732_077127 | 3300042656 | Bacteria | 10739 |
| 186 | Ga0466694_130714 | 3300042594 | Bacteria | 3431 |
| 187 | Ga0466696_161068 | 3300042596 | Bacteria | 13238 |
| 188 | Ga0466699_108400 | 3300042597 | Bacteria | 1185 |
| 189 | JGI24698J34947_10020619 | 3300002449 | Bacteria | 3549 |
| 190 | JGI24695J34938_10000924 | 3300002450 | Bacteria | 26865 |
| 191 | JGI24695J34938_10003462 | 3300002450 | Bacteria | 11009 |
| 192 | JGI24695J34938_10031224 | 3300002450 | Unclassified | 2474 |
| 193 | JGI24695J34938_10043048 | 3300002450 | Bacteria | 2017 |
| 194 | JGI24695J34938_10074386 | 3300002450 | Unclassified | 1413 |
| 195 | JGI24705J35276_12170709 | 3300002504 | Bacteria | 1291 |
| 196 | JGI24696J40584_12949056 | 3300002834 | Bacteria | 2047 |
| 197 | Ga0466712_038926 | 3300042614 | Bacteria | 2636 |
| 198 | Ga0466712_063875 | 3300042614 | Bacteria | 6974 |
| 199 | Ga0466712_110303 | 3300042614 | Bacteria | 2592 |
| 200 | Ga0466712_184346 | 3300042614 | Bacteria | 11159 |
| 201 | Ga0466723_126691 | 3300042618 | Bacteria | 31617 |
| 202 | Ga0466714_093446 | 3300042603 | Bacteria | 1430 |
| 203 | Ga0466716_096865 | 3300042605 | Bacteria | 2695 |
| 204 | Ga0466731_374498 | 3300042622 | Bacteria | 1320 |
| 205 | Ga0466735_166799 | 3300042624 | Bacteria | 2937 |
| 206 | Ga0466703_238292 | 3300042636 | Bacteria | 7041 |
| 207 | Ga0466704_041226 | 3300042643 | Bacteria | 2597 |
| 208 | Ga0466727_171922 | 3300042655 | Bacteria | 1066 |
| 209 | Ga0123356_10001926 | 3300010049 | Bacteria | 22481 |
| 210 | Ga0123356_10023717 | 3300010049 | Bacteria | 5772 |
| 211 | Ga0123356_10039475 | 3300010049 | Bacteria | 4398 |
| 212 | Ga0123356_10067440 | 3300010049 | Bacteria | 3351 |
| 213 | Ga0123356_10083733 | 3300010049 | Bacteria | 3022 |
| 214 | Ga0123356_10554196 | 3300010049 | Bacteria | 1311 |
| 215 | Ga0123356_10596086 | 3300010049 | Bacteria | 1269 |
| 216 | Ga0123353_10022424 | 3300010167 | Archaea | 9521 |
| 217 | Ga0123353_10040261 | 3300010167 | Bacteria | 7371 |
| 218 | Ga0123353_10230782 | 3300010167 | Bacteria | 2886 |
| 219 | Ga0123353_10413036 | 3300010167 | Unclassified | 2003 |
| 220 | Ga0466705_239320 | 3300042612 | Bacteria | 1866 |
| 221 | Ga0466705_288129 | 3300042612 | Bacteria | 8544 |
| 222 | Ga0466693_399181 | 3300042592 | Bacteria | 8838 |
| 223 | Ga0466694_252382 | 3300042594 | Bacteria | 4087 |
| 224 | Ga0466696_102505 | 3300042596 | Bacteria | 2580 |
| 225 | JGI24702J35022_10003285 | 3300002462 | Bacteria | 9765 |
| 226 | Ga0072941_1006236 | 3300005201 | Bacteria | 18660 |
| 227 | Ga0466712_025980 | 3300042614 | Bacteria | 4889 |
| 228 | Ga0466712_031014 | 3300042614 | Bacteria | 22253 |
| 229 | Ga0466712_044352 | 3300042614 | Bacteria | 6438 |
| 230 | Ga0466712_278757 | 3300042614 | Bacteria | 4736 |
| 231 | Ga0466711_007344 | 3300042615 | Bacteria | 12921 |
| 232 | Ga0466700_272007 | 3300042600 | Bacteria | 1115 |
| 233 | Ga0466700_344187 | 3300042600 | Bacteria | 1458 |
| 234 | Ga0466707_122800 | 3300042601 | Bacteria | 2243 |
| 235 | Ga0466707_243894 | 3300042601 | Bacteria | 1415 |
| 236 | Ga0466719_002009 | 3300042606 | Bacteria | 1324 |
| 237 | Ga0466719_380692 | 3300042606 | Bacteria | 2615 |
| 238 | Ga0466720_202553 | 3300042607 | Bacteria | 1415 |
| 239 | Ga0466721_290246 | 3300042608 | Bacteria | 1012 |
| 240 | Ga0466722_052974 | 3300042609 | Bacteria | 49936 |
| 241 | Ga0466731_110688 | 3300042622 | Bacteria | 4162 |
| 242 | Ga0466731_123910 | 3300042622 | Bacteria | 1848 |
| 243 | Ga0466735_199459 | 3300042624 | Bacteria | 1589 |
| 244 | Ga0466703_003148 | 3300042636 | Bacteria | 15239 |
| 245 | Ga0466703_032733 | 3300042636 | Bacteria | 48215 |
| 246 | Ga0466703_173650 | 3300042636 | Bacteria | 11061 |
| 247 | Ga0466704_010321 | 3300042643 | Bacteria | 14726 |
| 248 | Ga0466704_186258 | 3300042643 | Bacteria | 1619 |
| 249 | Ga0466727_197489 | 3300042655 | Bacteria | 2062 |
| 250 | Ga0123355_10000009 | 3300009826 | Bacteria | 191038 |
| 251 | Ga0123355_10000055 | 3300009826 | Bacteria | 117901 |
| 252 | Ga0123356_10001193 | 3300010049 | Bacteria | 28779 |
| 253 | Ga0123356_10059666 | 3300010049 | Archaea | 3559 |
| 254 | Ga0123353_10002982 | 3300010167 | Bacteria | 21189 |
| 255 | Ga0123353_10145106 | 3300010167 | Bacteria | 3796 |
| 256 | Ga0466690_267046 | 3300042590 | Bacteria | 1203 |
| 257 | Ga0466693_069990 | 3300042592 | Bacteria | 4727 |
| 258 | Ga0466691_026672 | 3300042593 | Bacteria | 1656 |
| 259 | Ga0466694_274764 | 3300042594 | Bacteria | 43729 |
| 260 | Ga0466694_368794 | 3300042594 | Bacteria | 4208 |
| 261 | Ga0466699_188309 | 3300042597 | Bacteria | 7559 |
| 262 | IMNBL1DRAFT_c0000292 | 3300000062 | Bacteria | 43151 |
| 263 | JGI24695J34938_10000218 | 3300002450 | Bacteria | 55166 |
| 264 | JGI24695J34938_10005280 | 3300002450 | Bacteria | 8117 |
| 265 | JGI24695J34938_10021489 | 3300002450 | Unclassified | 3155 |
| 266 | JGI24695J34938_10041762 | 3300002450 | Bacteria | 2057 |
| 267 | JGI24696J40584_12956492 | 3300002834 | Bacteria | 3131 |
| 268 | Ga0072941_1006732 | 3300005201 | Bacteria | 64519 |
| 269 | Ga0466712_032648 | 3300042614 | Unclassified | 5978 |
| 270 | Ga0466712_045974 | 3300042614 | Bacteria | 18529 |
| 271 | Ga0466711_039528 | 3300042615 | Bacteria | 6104 |
| 272 | Ga0466715_283628 | 3300042616 | Bacteria | 14220 |
| 273 | Ga0466718_105890 | 3300042617 | Bacteria | 2186 |
| 274 | Ga0466728_011507 | 3300042620 | Bacteria | 2506 |
| 275 | Ga0466700_456083 | 3300042600 | Bacteria | 1430 |
| 276 | Ga0466707_060040 | 3300042601 | Bacteria | 1797 |
| 277 | Ga0466707_410368 | 3300042601 | Bacteria | 11292 |
| 278 | Ga0466719_023969 | 3300042606 | Bacteria | 1949 |
| 279 | Ga0466719_034649 | 3300042606 | Bacteria | 4316 |
| 280 | Ga0466720_043373 | 3300042607 | Bacteria | 2552 |
| 281 | Ga0466698_131779 | 3300042610 | Bacteria | 7663 |
| 282 | Ga0466698_263895 | 3300042610 | Bacteria | 2518 |
| 283 | Ga0466729_287433 | 3300042621 | Bacteria | 20005 |
| 284 | Ga0466731_337384 | 3300042622 | Bacteria | 6120 |
| 285 | Ga0466731_428375 | 3300042622 | Bacteria | 1844 |
| 286 | Ga0466730_061209 | 3300042625 | Bacteria | 1007 |
| 287 | Ga0466702_210620 | 3300042635 | Bacteria | 1622 |
| 288 | Ga0466703_012439 | 3300042636 | Bacteria | 1703 |
| 289 | Ga0466703_033633 | 3300042636 | Bacteria | 4621 |
| 290 | Ga0466703_305858 | 3300042636 | Bacteria | 5305 |
| 291 | Ga0466704_019687 | 3300042643 | Bacteria | 3859 |
| 292 | Ga0466727_002760 | 3300042655 | Bacteria | 1583 |
| 293 | Ga0466727_048767 | 3300042655 | Bacteria | 6977 |
| 294 | Ga0123356_10043609 | 3300010049 | Bacteria | 4176 |
| 295 | Ga0123353_10138868 | 3300010167 | Bacteria | 3895 |
| 296 | Ga0123353_10502490 | 3300010167 | Unclassified | 1766 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04055 | Radical_SAM | Radical SAM superfamily | 46 | 213 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.