Protein Family IF05919
Metagenome
Isolate
200
Members
65
Samples
188
Scaffolds
134.19
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_252930|Ga0466707_252930_616_1005
- Length
- 129 aa
- Sequence
- MYYCEIKKEGDRYIVYFPDMPNVKTCGDTQEEALFMAEDALNAVLESEIEQGLAVRSPVYKNGYPIPVSNNVFLSMQLRGSLSQTDIAKKLGMTYQSYQRLENPRKANPTIKTLEKIARVYGRQLSIVM
Sample Types
Isolate
6.0%
Metagenome
94.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.2%
Unclassified
24.2%
Kalotermitidae
17.7%
Rhinotermitidae
6.5%
Termopsidae
4.8%
Tenebrionidae
1.6%
Taxonomy
Archaea
3
Bacteria
178
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 2 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 17 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 18 | 2820025825 | Unclassified Spirochaetes Lab288P1bin8 | Isolate | Unclassified |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 34 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 35 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 36 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 37 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 42 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 43 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 46 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 55 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 56 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 57 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 59 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 60 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 61 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 62 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 63 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 64 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 65 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_110418 | 3300042614 | Unclassified | 16942 |
| 2 | Ga0466712_285876 | 3300042614 | Bacteria | 7090 |
| 3 | Ga0466711_037050 | 3300042615 | Bacteria | 11249 |
| 4 | Ga0466715_072850 | 3300042616 | Bacteria | 10551 |
| 5 | Ga0466718_047166 | 3300042617 | Archaea | 5122 |
| 6 | Ga0466718_162463 | 3300042617 | Bacteria | 1050 |
| 7 | Ga0466726_352358 | 3300042619 | Bacteria | 1188 |
| 8 | Ga0123357_10295428 | 3300009784 | Archaea | 1647 |
| 9 | Ga0123353_10734427 | 3300010167 | Bacteria | 1378 |
| 10 | Ga0123353_11617033 | 3300010167 | Bacteria | 817 |
| 11 | Ga0123354_10645349 | 3300010882 | Bacteria | 758 |
| 12 | Ga0466704_020953 | 3300042643 | Bacteria | 2356 |
| 13 | Ga0466704_317785 | 3300042643 | Bacteria | 1346 |
| 14 | Ga0466708_122795 | 3300042652 | Bacteria | 12518 |
| 15 | Ga0466727_274482 | 3300042655 | Bacteria | 1677 |
| 16 | Ga0466707_267120 | 3300042601 | Bacteria | 1019 |
| 17 | Ga0466720_051003 | 3300042607 | Bacteria | 2765 |
| 18 | Nasutiter_Contig03855 | 2030936001 | Bacteria | 1881 |
| 19 | JGI24698J34947_10033865 | 3300002449 | Bacteria | 2677 |
| 20 | JGI24703J35330_10850429 | 3300002501 | Bacteria | 558 |
| 21 | JGI24705J35276_12209442 | 3300002504 | Bacteria | 1798 |
| 22 | Ga0072940_1017467 | 3300005200 | Unclassified | 14157 |
| 23 | Ga0072940_1049622 | 3300005200 | Bacteria | 769 |
| 24 | Ga0466690_220857 | 3300042590 | Bacteria | 2142 |
| 25 | Ga0466691_027195 | 3300042593 | Bacteria | 5570 |
| 26 | Ga0466691_095675 | 3300042593 | Bacteria | 20573 |
| 27 | Ga0466694_254588 | 3300042594 | Bacteria | 1707 |
| 28 | Ga0466694_308694 | 3300042594 | Bacteria | 17575 |
| 29 | Ga0466705_403279 | 3300042612 | Bacteria | 3089 |
| 30 | Ga0466718_055358 | 3300042617 | Bacteria | 2038 |
| 31 | Ga0466726_008599 | 3300042619 | Bacteria | 4402 |
| 32 | Ga0466729_137913 | 3300042621 | Bacteria | 4214 |
| 33 | Ga0123357_11032556 | 3300009784 | Bacteria | 506 |
| 34 | Ga0123353_10445672 | 3300010167 | Bacteria | 1908 |
| 35 | Ga0466735_005711 | 3300042624 | Bacteria | 2927 |
| 36 | Ga0466703_027380 | 3300042636 | Bacteria | 3339 |
| 37 | Ga0466727_321617 | 3300042655 | Bacteria | 1241 |
| 38 | Ga0466722_073664 | 3300042609 | Bacteria | 3683 |
| 39 | Ga0466698_124931 | 3300042610 | Unclassified | 1472 |
| 40 | JGI24698J34947_10027761 | 3300002449 | Archaea | 3002 |
| 41 | JGI24698J34947_10072959 | 3300002449 | Bacteria | 1640 |
| 42 | JGI24705J35276_11953927 | 3300002504 | Bacteria | 798 |
| 43 | JGI24705J35276_12102435 | 3300002504 | Bacteria | 1022 |
| 44 | JGI24697J35500_11057896 | 3300002507 | Bacteria | 1055 |
| 45 | Ga0466694_370437 | 3300042594 | Bacteria | 2676 |
| 46 | Ga0466699_140301 | 3300042597 | Unclassified | 2400 |
| 47 | Ga0466712_150544 | 3300042614 | Bacteria | 1817 |
| 48 | Ga0466712_236438 | 3300042614 | Unclassified | 2471 |
| 49 | Ga0466711_175105 | 3300042615 | Bacteria | 7931 |
| 50 | Ga0466711_228978 | 3300042615 | Bacteria | 1517 |
| 51 | Ga0466718_122014 | 3300042617 | Bacteria | 5697 |
| 52 | Ga0466723_053405 | 3300042618 | Bacteria | 7933 |
| 53 | Ga0123353_10495015 | 3300010167 | Bacteria | 1783 |
| 54 | Ga0123353_11394035 | 3300010167 | Bacteria | 902 |
| 55 | Ga0123354_10052179 | 3300010882 | Bacteria | 6163 |
| 56 | Ga0466729_295092 | 3300042621 | Bacteria | 1366 |
| 57 | Ga0466735_078623 | 3300042624 | Bacteria | 6411 |
| 58 | Ga0466708_207444 | 3300042652 | Bacteria | 3837 |
| 59 | Ga0466727_009803 | 3300042655 | Unclassified | 1249 |
| 60 | Ga0466700_125113 | 3300042600 | Bacteria | 1866 |
| 61 | Ga0466700_355599 | 3300042600 | Bacteria | 1888 |
| 62 | Ga0466719_195125 | 3300042606 | Bacteria | 3271 |
| 63 | Ga0466719_351417 | 3300042606 | Bacteria | 1499 |
| 64 | Ga0466720_155951 | 3300042607 | Bacteria | 3276 |
| 65 | Ga0466722_126301 | 3300042609 | Bacteria | 1126 |
| 66 | AustNasuHG_c1002967 | 3300000089 | Bacteria | 6114 |
| 67 | JGI24698J34947_10015131 | 3300002449 | Bacteria | 4201 |
| 68 | JGI24698J34947_10040279 | 3300002449 | Unclassified | 2413 |
| 69 | Ga0415639_003426 | 3300038395 | Bacteria | 1676 |
| 70 | Ga0456237_0034824 | 3300041968 | Bacteria | 670 |
| 71 | Ga0466690_095471 | 3300042590 | Bacteria | 57449 |
| 72 | Ga0466694_073398 | 3300042594 | Bacteria | 4080 |
| 73 | Ga0466699_162455 | 3300042597 | Bacteria | 6521 |
| 74 | Ga0530661_017425 | 3300056564 | Bacteria | 2024 |
| 75 | Ga0466705_458861 | 3300042612 | Bacteria | 1012 |
| 76 | Ga0466726_123066 | 3300042619 | Bacteria | 1514 |
| 77 | Ga0466726_168624 | 3300042619 | Bacteria | 2145 |
| 78 | Ga0466726_266512 | 3300042619 | Bacteria | 2338 |
| 79 | Ga0123355_10425466 | 3300009826 | Bacteria | 1693 |
| 80 | Ga0466703_020566 | 3300042636 | Bacteria | 18585 |
| 81 | Ga0466703_252543 | 3300042636 | Bacteria | 2896 |
| 82 | Ga0466727_297702 | 3300042655 | Unclassified | 1066 |
| 83 | Ga0466701_050204 | 3300042598 | Bacteria | 1849 |
| 84 | Ga0466707_016278 | 3300042601 | Bacteria | 6816 |
| 85 | Ga0466707_252930 | 3300042601 | Bacteria | 1286 |
| 86 | Ga0466720_056564 | 3300042607 | Bacteria | 1044 |
| 87 | FAAS_10260008 | 3300001880 | Bacteria | 504 |
| 88 | JGI24698J34947_10000502 | 3300002449 | Bacteria | 18409 |
| 89 | JGI24698J34947_10060065 | 3300002449 | Bacteria | 1877 |
| 90 | JGI24695J34938_10001698 | 3300002450 | Bacteria | 18200 |
| 91 | JGI24695J34938_10017161 | 3300002450 | Bacteria | 3658 |
| 92 | JGI24702J35022_10001698 | 3300002462 | Bacteria | 13653 |
| 93 | JGI24696J40584_12943873 | 3300002834 | Bacteria | 1790 |
| 94 | Ga0072940_1080251 | 3300005200 | Bacteria | 1463 |
| 95 | Ga0072941_1055327 | 3300005201 | Bacteria | 1631 |
| 96 | Ga0466692_056029 | 3300042591 | Bacteria | 2296 |
| 97 | Ga0466694_314535 | 3300042594 | Bacteria | 20936 |
| 98 | Ga0466712_067867 | 3300042614 | Bacteria | 8128 |
| 99 | Ga0466712_122808 | 3300042614 | Unclassified | 12193 |
| 100 | Ga0466712_135383 | 3300042614 | Unclassified | 2377 |
| 101 | Ga0466712_155267 | 3300042614 | Bacteria | 30530 |
| 102 | Ga0466712_215932 | 3300042614 | Bacteria | 17601 |
| 103 | Ga0466718_007027 | 3300042617 | Bacteria | 1183 |
| 104 | Ga0466726_367794 | 3300042619 | Bacteria | 1051 |
| 105 | Ga0123353_11409425 | 3300010167 | Bacteria | 895 |
| 106 | Ga0123353_11564389 | 3300010167 | Bacteria | 835 |
| 107 | Ga0123353_12256952 | 3300010167 | Bacteria | 656 |
| 108 | Ga0466703_278570 | 3300042636 | Bacteria | 2188 |
| 109 | Ga0466727_084284 | 3300042655 | Bacteria | 1056 |
| 110 | Ga0466707_293598 | 3300042601 | Bacteria | 1622 |
| 111 | Ga0466707_378988 | 3300042601 | Bacteria | 1896 |
| 112 | Ga0466713_011717 | 3300042602 | Bacteria | 2452 |
| 113 | JGI24698J34947_10001742 | 3300002449 | Bacteria | 11593 |
| 114 | JGI24698J34947_10005089 | 3300002449 | Bacteria | 7202 |
| 115 | JGI24698J34947_10151458 | 3300002449 | Unclassified | 962 |
| 116 | Ga0068305_10915585 | 3300005083 | Bacteria | 1565 |
| 117 | Ga0072940_1146211 | 3300005200 | Unclassified | 832 |
| 118 | Ga0072941_1008969 | 3300005201 | Bacteria | 11007 |
| 119 | Ga0466692_187814 | 3300042591 | Bacteria | 2507 |
| 120 | Ga0466699_102338 | 3300042597 | Bacteria | 5646 |
| 121 | Ga0466699_206758 | 3300042597 | Bacteria | 1609 |
| 122 | Ga0466699_401157 | 3300042597 | Bacteria | 2313 |
| 123 | Ga0466732_305626 | 3300042656 | Bacteria | 3537 |
| 124 | Ga0466705_455600 | 3300042612 | Unclassified | 4119 |
| 125 | Ga0466712_002757 | 3300042614 | Bacteria | 12771 |
| 126 | Ga0466712_034572 | 3300042614 | Bacteria | 2621 |
| 127 | Ga0466712_102314 | 3300042614 | Bacteria | 2351 |
| 128 | Ga0466712_243934 | 3300042614 | Unclassified | 2013 |
| 129 | Ga0466712_309428 | 3300042614 | Bacteria | 2883 |
| 130 | Ga0466711_438908 | 3300042615 | Bacteria | 1757 |
| 131 | Ga0466718_125138 | 3300042617 | Bacteria | 4073 |
| 132 | Ga0466729_276505 | 3300042621 | Bacteria | 1114 |
| 133 | Ga0466704_043323 | 3300042643 | Bacteria | 77338 |
| 134 | Ga0466708_222624 | 3300042652 | Bacteria | 1845 |
| 135 | Ga0466707_172449 | 3300042601 | Bacteria | 1006 |
| 136 | Ga0466719_217979 | 3300042606 | Bacteria | 1561 |
| 137 | Ga0466698_076892 | 3300042610 | Bacteria | 1015 |
| 138 | JGI24698J34947_10000226 | 3300002449 | Bacteria | 23328 |
| 139 | JGI24698J34947_10005952 | 3300002449 | Bacteria | 6693 |
| 140 | JGI24698J34947_10035698 | 3300002449 | Unclassified | 2593 |
| 141 | JGI24695J34938_10004033 | 3300002450 | Bacteria | 9865 |
| 142 | JGI24695J34938_10032005 | 3300002450 | Bacteria | 2434 |
| 143 | JGI24702J35022_10059985 | 3300002462 | Bacteria | 2033 |
| 144 | Ga0072940_1174137 | 3300005200 | Bacteria | 609 |
| 145 | Ga0074263_113721 | 3300005485 | Bacteria | 888 |
| 146 | Ga0466699_009001 | 3300042597 | Bacteria | 3318 |
| 147 | Ga0466699_147164 | 3300042597 | Bacteria | 1022 |
| 148 | Ga0466705_467529 | 3300042612 | Bacteria | 2586 |
| 149 | Ga0466712_149847 | 3300042614 | Bacteria | 7859 |
| 150 | Ga0466711_379155 | 3300042615 | Bacteria | 21372 |
| 151 | Ga0466718_128412 | 3300042617 | Unclassified | 1377 |
| 152 | Ga0466728_247268 | 3300042620 | Bacteria | 2290 |
| 153 | Ga0466729_125736 | 3300042621 | Bacteria | 1884 |
| 154 | Ga0123353_10251919 | 3300010167 | Bacteria | 2734 |
| 155 | Ga0466702_057503 | 3300042635 | Bacteria | 5229 |
| 156 | Ga0466704_164737 | 3300042643 | Bacteria | 7769 |
| 157 | Ga0466708_195107 | 3300042652 | Bacteria | 2049 |
| 158 | Ga0466707_074630 | 3300042601 | Bacteria | 7182 |
| 159 | Ga0466722_216378 | 3300042609 | Bacteria | 2514 |
| 160 | Ga0466698_488127 | 3300042610 | Bacteria | 1103 |
| 161 | AustNasuHG_c1006463 | 3300000089 | Bacteria | 4179 |
| 162 | Ga0456237_0009503 | 3300041968 | Bacteria | 1447 |
| 163 | Ga0466692_109264 | 3300042591 | Bacteria | 1942 |
| 164 | Ga0466699_008978 | 3300042597 | Bacteria | 3222 |
| 165 | Ga0466699_105796 | 3300042597 | Bacteria | 1260 |
| 166 | Ga0466699_279403 | 3300042597 | Bacteria | 1322 |
| 167 | Ga0466732_131977 | 3300042656 | Bacteria | 4640 |
| 168 | Ga0466733_179368 | 3300042659 | Bacteria | 1761 |
| 169 | Ga0466733_184379 | 3300042659 | Bacteria | 25802 |
| 170 | Ga0466712_231195 | 3300042614 | Bacteria | 9467 |
| 171 | Ga0466712_262020 | 3300042614 | Bacteria | 10459 |
| 172 | Ga0466715_290822 | 3300042616 | Bacteria | 3325 |
| 173 | Ga0466718_007383 | 3300042617 | Bacteria | 6793 |
| 174 | Ga0466723_078585 | 3300042618 | Bacteria | 4999 |
| 175 | Ga0466726_058647 | 3300042619 | Unclassified | 1530 |
| 176 | Ga0466726_169283 | 3300042619 | Bacteria | 1035 |
| 177 | Ga0466728_425324 | 3300042620 | Bacteria | 1041 |
| 178 | Ga0466731_054514 | 3300042622 | Unclassified | 2194 |
| 179 | Ga0466735_158851 | 3300042624 | Bacteria | 1454 |
| 180 | Ga0466707_306647 | 3300042601 | Bacteria | 1015 |
| 181 | Ga0466720_015131 | 3300042607 | Bacteria | 8403 |
| 182 | Ga0466698_117756 | 3300042610 | Bacteria | 1201 |
| 183 | JGI24698J34947_10005644 | 3300002449 | Bacteria | 6860 |
| 184 | JGI24698J34947_10139218 | 3300002449 | Bacteria | 1025 |
| 185 | Ga0072940_1182798 | 3300005200 | Bacteria | 767 |
| 186 | Ga0264413_139796 | 3300024493 | Bacteria | 3649 |
| 187 | Ga0466692_132864 | 3300042591 | Unclassified | 1424 |
| 188 | Ga0466699_380994 | 3300042597 | Bacteria | 1476 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.