Protein Family IF05912
Metagenome
Isolate
126
Members
51
Samples
108
Scaffolds
283.65
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_235805|Ga0466707_235805_2944_3924
- Length
- 326 aa
- Sequence
- LELRHKNTKIVQGIGKNKIIILSLQDFNKQIPKKMDNKTTKFDGSQIVLYQPDAVLQLEVRVENETVWLSQMQMATLFQTTRNNITMHIGNVFAEKELEEKSVRKDSLHTASDGKKYKTKYYNLDVIISVGYRVKSQRGTQFRIWANQVLKDYLLKGYAINQRIERLEKHAIETNRRIEMHENKIDFFVKMALPPIEGIFYDGQIFDAYAFVADLIKSAKTSIVLIDNYVDESVLLLLSKRKKDVNATIYTAYISDQLNLDLKKHNAQYPTIEIKQFTKSHDRFLIIDDVVYHIGASLKDLGKKWFAFSKMEIKGAFIMTSLLLNK
Sample Types
Isolate
13.5%
Metagenome
86.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.2%
Unclassified
29.4%
Kalotermitidae
17.6%
Termopsidae
5.9%
Rhinotermitidae
3.9%
Blattidae
2.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 2 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 3 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 8 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 11 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 16 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 17 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 30 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 40 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 41 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 42 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 45 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 49 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_039623 | 3300042599 | Bacteria | 3288 |
| 2 | Ga0466706_041479 | 3300042599 | Bacteria | 4369 |
| 3 | Ga0466707_402186 | 3300042601 | Bacteria | 60568 |
| 4 | Ga0466705_432211 | 3300042612 | Bacteria | 2647 |
| 5 | Ga0123357_10092087 | 3300009784 | Bacteria | 3945 |
| 6 | Ga0123355_10001154 | 3300009826 | Bacteria | 36615 |
| 7 | Ga0123353_10001789 | 3300010167 | Unclassified | 26417 |
| 8 | Ga0123353_10281455 | 3300010167 | Bacteria | 2554 |
| 9 | Ga0466729_313877 | 3300042621 | Bacteria | 1351 |
| 10 | Ga0466704_571559 | 3300042643 | Bacteria | 1064 |
| 11 | Ga0466727_294858 | 3300042655 | Bacteria | 5510 |
| 12 | Ga0466690_037046 | 3300042590 | Bacteria | 5448 |
| 13 | Ga0466691_023019 | 3300042593 | Bacteria | 12671 |
| 14 | Ga0466705_117748 | 3300042612 | Bacteria | 2197 |
| 15 | Ga0466714_015498 | 3300042603 | Bacteria | 1466 |
| 16 | Ga0466719_358809 | 3300042606 | Bacteria | 1153 |
| 17 | Ga0466711_125740 | 3300042615 | Bacteria | 1672 |
| 18 | Ga0123355_10000106 | 3300009826 | Bacteria | 92457 |
| 19 | Ga0123356_10003354 | 3300010049 | Bacteria | 16814 |
| 20 | Ga0123353_10957482 | 3300010167 | Bacteria | 1157 |
| 21 | Ga0123354_10310370 | 3300010882 | Bacteria | 1474 |
| 22 | Ga0466735_092936 | 3300042624 | Bacteria | 6469 |
| 23 | Ga0466703_226114 | 3300042636 | Bacteria | 10239 |
| 24 | JGI24695J34938_10004784 | 3300002450 | Bacteria | 8715 |
| 25 | Ga0068302_10000031 | 3300005071 | Bacteria | 1648 |
| 26 | Ga0466656_285501 | 3300042550 | Bacteria | 1507 |
| 27 | Ga0466694_051269 | 3300042594 | Bacteria | 3152 |
| 28 | Ga0466705_022721 | 3300042612 | Bacteria | 3099 |
| 29 | Ga0466707_074553 | 3300042601 | Bacteria | 10604 |
| 30 | Ga0466707_183334 | 3300042601 | Bacteria | 1397 |
| 31 | Ga0466707_346505 | 3300042601 | Bacteria | 1524 |
| 32 | Ga0466716_265570 | 3300042605 | Bacteria | 2994 |
| 33 | Ga0466715_029251 | 3300042616 | Bacteria | 4961 |
| 34 | Ga0123355_10000263 | 3300009826 | Bacteria | 67357 |
| 35 | Ga0123353_10077503 | 3300010167 | Bacteria | 5341 |
| 36 | Ga0123354_10148154 | 3300010882 | Bacteria | 2860 |
| 37 | Ga0466703_266950 | 3300042636 | Bacteria | 1336 |
| 38 | Ga0466704_220182 | 3300042643 | Bacteria | 5863 |
| 39 | Ga0466725_436731 | 3300042654 | Bacteria | 1744 |
| 40 | Ga0123357_10001250 | 3300009784 | Bacteria | 26711 |
| 41 | Ga0466656_238420 | 3300042550 | Bacteria | 2973 |
| 42 | Ga0466693_059436 | 3300042592 | Bacteria | 2052 |
| 43 | Ga0466691_141135 | 3300042593 | Bacteria | 4270 |
| 44 | Ga0466694_168502 | 3300042594 | Bacteria | 4379 |
| 45 | Ga0466707_177487 | 3300042601 | Bacteria | 8579 |
| 46 | Ga0466707_235805 | 3300042601 | Bacteria | 4983 |
| 47 | Ga0466707_240944 | 3300042601 | Bacteria | 1020 |
| 48 | Ga0466707_354209 | 3300042601 | Bacteria | 6270 |
| 49 | Ga0123355_10402639 | 3300009826 | Bacteria | 1764 |
| 50 | Ga0123353_10344218 | 3300010167 | Bacteria | 2250 |
| 51 | Ga0123353_10588818 | 3300010167 | Bacteria | 1593 |
| 52 | Ga0466735_161789 | 3300042624 | Bacteria | 2390 |
| 53 | JGI24698J34947_10007864 | 3300002449 | Bacteria | 5854 |
| 54 | JGI24695J34938_10061697 | 3300002450 | Bacteria | 1595 |
| 55 | Ga0466691_031819 | 3300042593 | Bacteria | 14874 |
| 56 | Ga0466694_233171 | 3300042594 | Bacteria | 2362 |
| 57 | Ga0466733_184903 | 3300042659 | Bacteria | 1498 |
| 58 | Ga0466717_068164 | 3300042604 | Bacteria | 3749 |
| 59 | Ga0123357_10037335 | 3300009784 | Bacteria | 6612 |
| 60 | Ga0123353_10080347 | 3300010167 | Bacteria | 5243 |
| 61 | Ga0466735_089588 | 3300042624 | Bacteria | 2045 |
| 62 | Ga0466735_115475 | 3300042624 | Bacteria | 1987 |
| 63 | Ga0466657_165900 | 3300042582 | Bacteria | 2402 |
| 64 | Ga0466691_017102 | 3300042593 | Unclassified | 1748 |
| 65 | Ga0466707_078271 | 3300042601 | Bacteria | 19341 |
| 66 | Ga0123355_10001907 | 3300009826 | Bacteria | 29322 |
| 67 | Ga0123356_10291997 | 3300010049 | Bacteria | 1731 |
| 68 | Ga0123353_10204665 | 3300010167 | Bacteria | 3102 |
| 69 | Ga0466735_148823 | 3300042624 | Bacteria | 1603 |
| 70 | Ga0466703_033104 | 3300042636 | Bacteria | 1937 |
| 71 | Ga0466703_146763 | 3300042636 | Bacteria | 7913 |
| 72 | Ga0466704_107812 | 3300042643 | Bacteria | 5524 |
| 73 | Ga0466704_393013 | 3300042643 | Bacteria | 2000 |
| 74 | Ga0415639_042565 | 3300038395 | Bacteria | 1560 |
| 75 | Ga0466691_075601 | 3300042593 | Bacteria | 4360 |
| 76 | Ga0466705_178173 | 3300042612 | Bacteria | 18747 |
| 77 | Ga0466707_375900 | 3300042601 | Bacteria | 2197 |
| 78 | Ga0466707_403664 | 3300042601 | Bacteria | 44626 |
| 79 | Ga0466721_160705 | 3300042608 | Unclassified | 1236 |
| 80 | Ga0466721_368720 | 3300042608 | Bacteria | 9571 |
| 81 | Ga0466722_118900 | 3300042609 | Bacteria | 1856 |
| 82 | Ga0466711_175299 | 3300042615 | Bacteria | 29148 |
| 83 | Ga0466711_268980 | 3300042615 | Bacteria | 10316 |
| 84 | Ga0466711_282878 | 3300042615 | Bacteria | 1893 |
| 85 | Ga0123356_10482461 | 3300010049 | Bacteria | 1393 |
| 86 | Ga0123353_10429264 | 3300010167 | Bacteria | 1955 |
| 87 | Ga0123354_10261089 | 3300010882 | Bacteria | 1729 |
| 88 | Ga0466703_362102 | 3300042636 | Bacteria | 5254 |
| 89 | JGI24702J35022_10007916 | 3300002462 | Bacteria | 6050 |
| 90 | JGI24699J35502_11134184 | 3300002509 | Bacteria | 47712 |
| 91 | Ga0466656_356327 | 3300042550 | Bacteria | 1965 |
| 92 | Ga0466657_011776 | 3300042582 | Bacteria | 3359 |
| 93 | Ga0466694_041025 | 3300042594 | Bacteria | 2826 |
| 94 | Ga0466705_040655 | 3300042612 | Bacteria | 10984 |
| 95 | Ga0466733_199822 | 3300042659 | Bacteria | 1972 |
| 96 | Ga0466707_202638 | 3300042601 | Bacteria | 1441 |
| 97 | Ga0466707_242556 | 3300042601 | Bacteria | 3304 |
| 98 | Ga0466707_280524 | 3300042601 | Bacteria | 3101 |
| 99 | Ga0466705_402062 | 3300042612 | Bacteria | 2006 |
| 100 | Ga0123356_10004217 | 3300010049 | Bacteria | 14867 |
| 101 | Ga0123356_10374561 | 3300010049 | Bacteria | 1554 |
| 102 | Ga0123356_10484348 | 3300010049 | Bacteria | 1391 |
| 103 | Ga0466735_020881 | 3300042624 | Bacteria | 1151 |
| 104 | Ga0466724_69176 | 3300042649 | Bacteria | 3001 |
| 105 | Ga0466727_180220 | 3300042655 | Bacteria | 1265 |
| 106 | JGI24695J34938_10000514 | 3300002450 | Unclassified | 37726 |
| 107 | JGI24695J34938_10002169 | 3300002450 | Unclassified | 15316 |
| 108 | Ga0466693_394751 | 3300042592 | Bacteria | 1284 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13310 | Virulence_RhuM | Virulence protein RhuM family | 103 | 175 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.