Protein Family IF05904
Metagenome
Metatranscriptome
Isolate
211
Members
38
Samples
210
Scaffolds
114.82
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_220450|Ga0466707_220450_11087_11428
- Length
- 113 aa
- Sequence
- MKKIEAIIREEKLEDLKIALNELIDGMTISQILGYGKQRGFDEYVRGKAVPVQLLRKIKVEIVVTDDRVQTVIDKIIATCQTGEVGDGKIFVIPVENAIRISTNTAGDAAVTE
Sample Types
Isolate
0.5%
Metagenome
98.6%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.0%
Termitidae
25.7%
Unclassified
11.4%
Termopsidae
11.4%
Rhinotermitidae
5.7%
Hodotermitidae
2.9%
Passalidae
2.9%
Taxonomy
Archaea
1
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
55
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 2820716747 | Unclassified Fibrobacteres Nc150P3bin18 | Isolate | Unclassified |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_104306 | 3300024493 | Bacteria | 15415 |
| 2 | Ga0264413_104390 | 3300024493 | Bacteria | 22644 |
| 3 | Ga0466690_107830 | 3300042590 | Unclassified | 1815 |
| 4 | Ga0466706_200672 | 3300042599 | Bacteria | 2970 |
| 5 | Ga0466706_216571 | 3300042599 | Bacteria | 19475 |
| 6 | Ga0466704_259354 | 3300042643 | Bacteria | 8150 |
| 7 | Ga0466708_443108 | 3300042652 | Bacteria | 4341 |
| 8 | Ga0466727_058782 | 3300042655 | Unclassified | 1277 |
| 9 | Ga0466711_077430 | 3300042615 | Unclassified | 2472 |
| 10 | Ga0466711_429928 | 3300042615 | Unclassified | 5034 |
| 11 | Ga0466715_385600 | 3300042616 | Bacteria | 18177 |
| 12 | Ga0466718_013931 | 3300042617 | Bacteria | 12457 |
| 13 | Ga0466718_070352 | 3300042617 | Unclassified | 2494 |
| 14 | Ga0466718_078287 | 3300042617 | Bacteria | 19522 |
| 15 | Ga0466718_119764 | 3300042617 | Unclassified | 1196 |
| 16 | Ga0466723_230572 | 3300042618 | Unclassified | 4777 |
| 17 | Ga0466726_064363 | 3300042619 | Bacteria | 1242 |
| 18 | Ga0466728_260897 | 3300042620 | Bacteria | 16779 |
| 19 | Ga0068305_10006317 | 3300005083 | Bacteria | 4690 |
| 20 | Ga0072941_1239520 | 3300005201 | Bacteria | 899 |
| 21 | Ga0074263_102872 | 3300005485 | Unclassified | 2169 |
| 22 | Ga0466705_268945 | 3300042612 | Bacteria | 16408 |
| 23 | Ga0466705_325285 | 3300042612 | Bacteria | 29076 |
| 24 | Ga0466691_056444 | 3300042593 | Unclassified | 1585 |
| 25 | Ga0466696_167776 | 3300042596 | Bacteria | 2802 |
| 26 | Ga0466706_074596 | 3300042599 | Bacteria | 1425 |
| 27 | Ga0466707_015851 | 3300042601 | Bacteria | 7041 |
| 28 | Ga0466707_188479 | 3300042601 | Bacteria | 2673 |
| 29 | Ga0466707_220450 | 3300042601 | Bacteria | 25239 |
| 30 | Ga0466716_410828 | 3300042605 | Bacteria | 1413 |
| 31 | Ga0466729_247344 | 3300042621 | Bacteria | 73177 |
| 32 | Ga0466704_494494 | 3300042643 | Bacteria | 1519 |
| 33 | Ga0466708_252052 | 3300042652 | Bacteria | 26518 |
| 34 | Ga0466727_285590 | 3300042655 | Bacteria | 7157 |
| 35 | Ga0466715_217757 | 3300042616 | Bacteria | 15762 |
| 36 | Ga0466718_115277 | 3300042617 | Bacteria | 30003 |
| 37 | Ga0466723_137817 | 3300042618 | Bacteria | 12808 |
| 38 | Ga0466728_003045 | 3300042620 | Bacteria | 90142 |
| 39 | Ga0466728_420108 | 3300042620 | Unclassified | 1081 |
| 40 | IMNBL1DRAFT_c0199336 | 3300000062 | Bacteria | 502 |
| 41 | FAAS_10745089 | 3300001880 | Unclassified | 528 |
| 42 | Ga0072940_1016224 | 3300005200 | Bacteria | 1311 |
| 43 | Ga0466705_171019 | 3300042612 | Bacteria | 78873 |
| 44 | Ga0264413_102606 | 3300024493 | Bacteria | 10653 |
| 45 | Ga0264413_104392 | 3300024493 | Bacteria | 10021 |
| 46 | Ga0466691_102305 | 3300042593 | Bacteria | 24120 |
| 47 | Ga0466691_195211 | 3300042593 | Unclassified | 1714 |
| 48 | Ga0466706_109444 | 3300042599 | Bacteria | 2503 |
| 49 | Ga0466707_158829 | 3300042601 | Bacteria | 178149 |
| 50 | Ga0466707_203324 | 3300042601 | Bacteria | 6023 |
| 51 | Ga0466707_285162 | 3300042601 | Bacteria | 31236 |
| 52 | Ga0466716_059623 | 3300042605 | Bacteria | 5004 |
| 53 | Ga0466716_077440 | 3300042605 | Bacteria | 33573 |
| 54 | Ga0466719_163634 | 3300042606 | Bacteria | 14566 |
| 55 | Ga0466720_096245 | 3300042607 | Bacteria | 19520 |
| 56 | Ga0466720_213983 | 3300042607 | Bacteria | 1098 |
| 57 | Ga0466698_095695 | 3300042610 | Bacteria | 2433 |
| 58 | Ga0466698_362188 | 3300042610 | Bacteria | 1602 |
| 59 | Ga0466703_212599 | 3300042636 | Unclassified | 1798 |
| 60 | Ga0466704_200695 | 3300042643 | Unclassified | 15064 |
| 61 | Ga0466727_277996 | 3300042655 | Bacteria | 60667 |
| 62 | Ga0466711_343640 | 3300042615 | Bacteria | 4027 |
| 63 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 64 | Ga0466715_306990 | 3300042616 | Bacteria | 3462 |
| 65 | Ga0466723_283555 | 3300042618 | Unclassified | 14617 |
| 66 | Ga0466726_235661 | 3300042619 | Bacteria | 1248 |
| 67 | Ga0466726_384394 | 3300042619 | Bacteria | 8551 |
| 68 | Ga0466726_418568 | 3300042619 | Bacteria | 2527 |
| 69 | Ga0466728_150819 | 3300042620 | Unclassified | 1824 |
| 70 | Ga0466728_181562 | 3300042620 | Unclassified | 3441 |
| 71 | Ga0466729_072144 | 3300042621 | Bacteria | 3553 |
| 72 | Ga0466729_191211 | 3300042621 | Unclassified | 13643 |
| 73 | JGI24698J34947_10234010 | 3300002449 | Unclassified | 696 |
| 74 | Ga0068305_10134408 | 3300005083 | Unclassified | 2231 |
| 75 | Ga0072940_1218935 | 3300005200 | Unclassified | 785 |
| 76 | Ga0466705_082319 | 3300042612 | Bacteria | 39236 |
| 77 | Ga0466691_161734 | 3300042593 | Bacteria | 1381 |
| 78 | Ga0466696_296078 | 3300042596 | Unclassified | 32496 |
| 79 | Ga0466706_269984 | 3300042599 | Unclassified | 1126 |
| 80 | Ga0466707_043753 | 3300042601 | Bacteria | 1122 |
| 81 | Ga0466716_305814 | 3300042605 | Unclassified | 2584 |
| 82 | Ga0466720_080347 | 3300042607 | Bacteria | 74454 |
| 83 | Ga0466698_099535 | 3300042610 | Bacteria | 2282 |
| 84 | Ga0466698_242043 | 3300042610 | Bacteria | 2445 |
| 85 | Ga0466703_094576 | 3300042636 | Bacteria | 1228 |
| 86 | Ga0466704_277744 | 3300042643 | Unclassified | 1009 |
| 87 | Ga0466705_439046 | 3300042612 | Bacteria | 3832 |
| 88 | Ga0466711_412034 | 3300042615 | Bacteria | 48036 |
| 89 | Ga0466715_335964 | 3300042616 | Bacteria | 23808 |
| 90 | Ga0466718_155380 | 3300042617 | Bacteria | 1086 |
| 91 | Ga0466718_164454 | 3300042617 | Bacteria | 10078 |
| 92 | Ga0466723_116319 | 3300042618 | Bacteria | 1057 |
| 93 | Ga0466723_374301 | 3300042618 | Bacteria | 12172 |
| 94 | Ga0466726_097258 | 3300042619 | Unclassified | 1616 |
| 95 | Ga0466726_191567 | 3300042619 | Bacteria | 1270 |
| 96 | IMNBL1DRAFT_c0027854 | 3300000062 | Bacteria | 2118 |
| 97 | Ga0072940_1092451 | 3300005200 | Unclassified | 769 |
| 98 | Ga0074263_102873 | 3300005485 | Unclassified | 2925 |
| 99 | Ga0255809_1018277 | 3300022820 | Unclassified | 775 |
| 100 | Ga0264413_131408 | 3300024493 | Bacteria | 1548 |
| 101 | Ga0466690_107088 | 3300042590 | Bacteria | 25813 |
| 102 | Ga0466690_221271 | 3300042590 | Bacteria | 3295 |
| 103 | Ga0466690_226741 | 3300042590 | Bacteria | 23229 |
| 104 | Ga0466691_001046 | 3300042593 | Unclassified | 6777 |
| 105 | Ga0466691_064308 | 3300042593 | Unclassified | 12654 |
| 106 | Ga0466706_097384 | 3300042599 | Bacteria | 2486 |
| 107 | Ga0466706_116541 | 3300042599 | Bacteria | 20078 |
| 108 | Ga0466707_049055 | 3300042601 | Bacteria | 33710 |
| 109 | Ga0466707_066700 | 3300042601 | Bacteria | 54784 |
| 110 | Ga0466707_129349 | 3300042601 | Bacteria | 13473 |
| 111 | Ga0466707_308256 | 3300042601 | Bacteria | 4652 |
| 112 | Ga0466716_119270 | 3300042605 | Bacteria | 2521 |
| 113 | Ga0466719_102704 | 3300042606 | Bacteria | 110867 |
| 114 | Ga0466708_456744 | 3300042652 | Bacteria | 3995 |
| 115 | Ga0466715_334606 | 3300042616 | Bacteria | 17315 |
| 116 | Ga0466715_395735 | 3300042616 | Bacteria | 16931 |
| 117 | Ga0466723_016560 | 3300042618 | Unclassified | 2559 |
| 118 | Ga0466723_035385 | 3300042618 | Unclassified | 9600 |
| 119 | Ga0466723_167160 | 3300042618 | Bacteria | 6423 |
| 120 | Ga0466723_275518 | 3300042618 | Bacteria | 71516 |
| 121 | Ga0466723_301126 | 3300042618 | Unclassified | 2303 |
| 122 | Ga0466723_362774 | 3300042618 | Bacteria | 14133 |
| 123 | Ga0466726_180553 | 3300042619 | Bacteria | 33938 |
| 124 | Ga0466726_217236 | 3300042619 | Bacteria | 220873 |
| 125 | Ga0466729_133905 | 3300042621 | Bacteria | 8185 |
| 126 | IMNBL1DRAFT_c0045058 | 3300000062 | Bacteria | 1443 |
| 127 | FAAS_10001553 | 3300001880 | Unclassified | 1876 |
| 128 | Ga0068305_10000090 | 3300005083 | Bacteria | 152414 |
| 129 | Ga0068305_10000140 | 3300005083 | Bacteria | 37543 |
| 130 | Ga0068305_10555026 | 3300005083 | Bacteria | 827 |
| 131 | Ga0072940_1016222 | 3300005200 | Unclassified | 2752 |
| 132 | Ga0466705_131706 | 3300042612 | Bacteria | 24644 |
| 133 | Ga0255809_1010891 | 3300022820 | Unclassified | 813 |
| 134 | Ga0466692_062087 | 3300042591 | Unclassified | 6962 |
| 135 | Ga0466691_217613 | 3300042593 | Bacteria | 1504 |
| 136 | Ga0466696_377138 | 3300042596 | Bacteria | 3009 |
| 137 | Ga0466706_199053 | 3300042599 | Bacteria | 1153 |
| 138 | Ga0466707_177882 | 3300042601 | Bacteria | 5507 |
| 139 | Ga0466707_203019 | 3300042601 | Bacteria | 47509 |
| 140 | Ga0466707_363765 | 3300042601 | Bacteria | 1314 |
| 141 | Ga0466716_059532 | 3300042605 | Unclassified | 1357 |
| 142 | Ga0466719_230217 | 3300042606 | Unclassified | 1237 |
| 143 | Ga0466719_575097 | 3300042606 | Bacteria | 1347 |
| 144 | Ga0466698_495675 | 3300042610 | Bacteria | 2231 |
| 145 | Ga0466735_055907 | 3300042624 | Unclassified | 4760 |
| 146 | Ga0466735_110459 | 3300042624 | Bacteria | 1019 |
| 147 | Ga0466703_395188 | 3300042636 | Bacteria | 299836 |
| 148 | Ga0466704_422762 | 3300042643 | Bacteria | 1498 |
| 149 | Ga0466712_022234 | 3300042614 | Bacteria | 2134 |
| 150 | Ga0466711_241009 | 3300042615 | Bacteria | 7517 |
| 151 | Ga0466711_355820 | 3300042615 | Bacteria | 54624 |
| 152 | Ga0466715_085309 | 3300042616 | Bacteria | 3743 |
| 153 | Ga0466715_130565 | 3300042616 | Bacteria | 11294 |
| 154 | Ga0466715_388302 | 3300042616 | Bacteria | 9406 |
| 155 | Ga0466715_612597 | 3300042616 | Bacteria | 2504 |
| 156 | Ga0466718_050376 | 3300042617 | Bacteria | 11331 |
| 157 | Ga0466723_002933 | 3300042618 | Bacteria | 27474 |
| 158 | Ga0466723_189064 | 3300042618 | Bacteria | 1159 |
| 159 | Ga0466723_233611 | 3300042618 | Bacteria | 5824 |
| 160 | Ga0466726_078640 | 3300042619 | Bacteria | 41565 |
| 161 | Ga0466726_087732 | 3300042619 | Bacteria | 1959 |
| 162 | JGI24699J35502_10836585 | 3300002509 | Bacteria | 932 |
| 163 | Ga0072940_1000189 | 3300005200 | Unclassified | 15392 |
| 164 | Ga0466705_065023 | 3300042612 | Bacteria | 38225 |
| 165 | Ga0466705_333997 | 3300042612 | Bacteria | 3502 |
| 166 | Ga0264413_109562 | 3300024493 | Bacteria | 22404 |
| 167 | Ga0466690_125881 | 3300042590 | Bacteria | 4701 |
| 168 | Ga0466690_180546 | 3300042590 | Unclassified | 3097 |
| 169 | Ga0466690_252949 | 3300042590 | Unclassified | 1743 |
| 170 | Ga0466691_002859 | 3300042593 | Bacteria | 11168 |
| 171 | Ga0466706_199359 | 3300042599 | Bacteria | 9372 |
| 172 | Ga0466707_134944 | 3300042601 | Bacteria | 69379 |
| 173 | Ga0466720_105536 | 3300042607 | Bacteria | 18084 |
| 174 | Ga0466704_264016 | 3300042643 | Bacteria | 19004 |
| 175 | Ga0466709_348252 | 3300042648 | Unclassified | 1929 |
| 176 | Ga0466715_469339 | 3300042616 | Bacteria | 13839 |
| 177 | Ga0466723_045798 | 3300042618 | Bacteria | 21643 |
| 178 | Ga0466723_206178 | 3300042618 | Unclassified | 5207 |
| 179 | Ga0466728_212418 | 3300042620 | Unclassified | 3000 |
| 180 | Ga0466728_413366 | 3300042620 | Bacteria | 1252 |
| 181 | Ga0068302_10268399 | 3300005071 | Bacteria | 722 |
| 182 | Ga0072940_1011806 | 3300005200 | Bacteria | 3785 |
| 183 | Ga0466705_129383 | 3300042612 | Bacteria | 8371 |
| 184 | Ga0264413_104391 | 3300024493 | Unclassified | 4842 |
| 185 | Ga0466690_083915 | 3300042590 | Bacteria | 7283 |
| 186 | Ga0466690_180483 | 3300042590 | Bacteria | 3333 |
| 187 | Ga0466707_075327 | 3300042601 | Bacteria | 20686 |
| 188 | Ga0466707_112238 | 3300042601 | Bacteria | 1480 |
| 189 | Ga0466707_138351 | 3300042601 | Bacteria | 14401 |
| 190 | Ga0466713_030109 | 3300042602 | Bacteria | 6568 |
| 191 | Ga0466713_104479 | 3300042602 | Archaea | 1872 |
| 192 | Ga0466713_131301 | 3300042602 | Bacteria | 63436 |
| 193 | Ga0466716_212922 | 3300042605 | Unclassified | 6087 |
| 194 | Ga0466720_098565 | 3300042607 | Bacteria | 21568 |
| 195 | Ga0466703_126804 | 3300042636 | Unclassified | 3156 |
| 196 | Ga0466704_593709 | 3300042643 | Bacteria | 19165 |
| 197 | Ga0466709_415196 | 3300042648 | Bacteria | 2843 |
| 198 | Ga0466715_222747 | 3300042616 | Bacteria | 1410 |
| 199 | Ga0466715_224944 | 3300042616 | Bacteria | 19907 |
| 200 | Ga0466718_033980 | 3300042617 | Bacteria | 1085 |
| 201 | Ga0466723_034095 | 3300042618 | Bacteria | 3974 |
| 202 | Ga0466723_044145 | 3300042618 | Unclassified | 4977 |
| 203 | Ga0466723_197228 | 3300042618 | Unclassified | 8518 |
| 204 | Ga0466723_209378 | 3300042618 | Unclassified | 22183 |
| 205 | Ga0466723_320945 | 3300042618 | Bacteria | 9805 |
| 206 | Ga0466726_110748 | 3300042619 | Bacteria | 4111 |
| 207 | Ga0466726_191206 | 3300042619 | Unclassified | 11030 |
| 208 | Ga0466726_243454 | 3300042619 | Bacteria | 18759 |
| 209 | JGI24699J35502_10892915 | 3300002509 | Bacteria | 1032 |
| 210 | Ga0068302_10019265 | 3300005071 | Unclassified | 2819 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00543 | P-II | Nitrogen regulatory protein P-II | 1 | 104 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.