Protein Family IF05896
Metagenome
Isolate
125
Members
46
Samples
115
Scaffolds
338.7
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_210372|Ga0466707_210372_7256_8263
- Length
- 335 aa
- Sequence
- MNLMQQIIARAQADKQRIVLPEGTEERTLKAADRLLADEVADLVLIGNPPEILRLAAGFKLSHIEKAVILDPKEYDKKEAYANLLFRLRQSKGMTLEKARELAENPLYLACLMIKSGDADGEIAGAHNTTSDVLRPALQIIKTAPGISCVSGAFLMFLPDKQYGEEGVLVFADCAVIPDPTAAEAAQIAIATAQTARNLAGMEPRVAMLSFSTKGSAGLADKMEEATRLARTLAPDLRIDGELQADAALVESVAAAKAPGSDIAGKANVLIFPTLAAGNIAYKLVQRLAKAEAIGPVLQGIAAPVNDLSRGCSVDDVYKMVAIACNQAIGLKTIK
Sample Types
Isolate
8.0%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
28.3%
Termitidae
26.1%
Unclassified
13.0%
Blattidae
8.7%
Rhinotermitidae
6.5%
Termopsidae
6.5%
Hydrophilidae
4.3%
Passalidae
4.3%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 6 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 12 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 18 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 19 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 28 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_308494 | 3300042606 | Bacteria | 8627 |
| 2 | Ga0466719_440367 | 3300042606 | Bacteria | 3345 |
| 3 | Ga0466719_449225 | 3300042606 | Bacteria | 5305 |
| 4 | Ga0466703_007800 | 3300042636 | Bacteria | 7419 |
| 5 | Ga0466703_209065 | 3300042636 | Bacteria | 24986 |
| 6 | Ga0466703_350774 | 3300042636 | Bacteria | 6452 |
| 7 | Ga0466704_066134 | 3300042643 | Bacteria | 4079 |
| 8 | Ga0466704_565073 | 3300042643 | Bacteria | 2708 |
| 9 | Ga0466727_220841 | 3300042655 | Bacteria | 5091 |
| 10 | Ga0466727_228319 | 3300042655 | Bacteria | 10404 |
| 11 | Ga0466727_238759 | 3300042655 | Bacteria | 22004 |
| 12 | Ga0466690_088762 | 3300042590 | Bacteria | 9583 |
| 13 | Ga0466690_314971 | 3300042590 | Bacteria | 5469 |
| 14 | Ga0466690_350930 | 3300042590 | Bacteria | 4194 |
| 15 | IMNBL1DRAFT_c0001271 | 3300000062 | Bacteria | 19012 |
| 16 | Ga0466733_021641 | 3300042659 | Bacteria | 1383 |
| 17 | Ga0466701_047815 | 3300042598 | Bacteria | 4449 |
| 18 | Ga0466714_051455 | 3300042603 | Bacteria | 64684 |
| 19 | Ga0466719_279508 | 3300042606 | Bacteria | 17811 |
| 20 | Ga0466709_227574 | 3300042648 | Bacteria | 4165 |
| 21 | Ga0466727_232018 | 3300042655 | Bacteria | 11620 |
| 22 | Ga0466727_300785 | 3300042655 | Bacteria | 6506 |
| 23 | Ga0466711_029466 | 3300042615 | Bacteria | 23911 |
| 24 | Ga0466692_087583 | 3300042591 | Bacteria | 1633 |
| 25 | 2227491304 | 2225789004 | Bacteria | 20472 |
| 26 | Ga0466707_250907 | 3300042601 | Bacteria | 1628 |
| 27 | Ga0466713_155470 | 3300042602 | Bacteria | 25745 |
| 28 | Ga0466719_257068 | 3300042606 | Bacteria | 36236 |
| 29 | Ga0466703_028614 | 3300042636 | Bacteria | 7924 |
| 30 | Ga0466703_039914 | 3300042636 | Bacteria | 11018 |
| 31 | Ga0466703_117432 | 3300042636 | Bacteria | 21621 |
| 32 | Ga0466703_250543 | 3300042636 | Bacteria | 6655 |
| 33 | Ga0123353_10277839 | 3300010167 | Bacteria | 2575 |
| 34 | Ga0123353_10841329 | 3300010167 | Bacteria | 1259 |
| 35 | Ga0466656_329958 | 3300042550 | Bacteria | 10511 |
| 36 | Ga0466693_335172 | 3300042592 | Bacteria | 3445 |
| 37 | Ga0466696_269250 | 3300042596 | Bacteria | 19487 |
| 38 | 2227441904 | 2225789004 | Bacteria | 25895 |
| 39 | JGI24702J35022_10004946 | 3300002462 | Bacteria | 7858 |
| 40 | Ga0068305_10063539 | 3300005083 | Bacteria | 7219 |
| 41 | Ga0466713_133892 | 3300042602 | Bacteria | 2693 |
| 42 | Ga0466703_377225 | 3300042636 | Bacteria | 1300 |
| 43 | Ga0466704_096661 | 3300042643 | Bacteria | 4524 |
| 44 | Ga0466704_097641 | 3300042643 | Bacteria | 12391 |
| 45 | Ga0466709_262791 | 3300042648 | Bacteria | 5919 |
| 46 | Ga0466715_032297 | 3300042616 | Bacteria | 33510 |
| 47 | Ga0466715_212319 | 3300042616 | Bacteria | 50715 |
| 48 | Ga0466726_259504 | 3300042619 | Bacteria | 10608 |
| 49 | Ga0466696_033419 | 3300042596 | Bacteria | 29709 |
| 50 | Ga0466696_338446 | 3300042596 | Bacteria | 7471 |
| 51 | Ga0466705_001839 | 3300042612 | Bacteria | 4250 |
| 52 | Ga0466733_046473 | 3300042659 | Bacteria | 56769 |
| 53 | Ga0466733_130937 | 3300042659 | Bacteria | 27936 |
| 54 | Ga0466706_061089 | 3300042599 | Bacteria | 16571 |
| 55 | Ga0466700_467341 | 3300042600 | Bacteria | 1949 |
| 56 | Ga0466714_001728 | 3300042603 | Bacteria | 35313 |
| 57 | Ga0466704_077855 | 3300042643 | Bacteria | 18698 |
| 58 | Ga0466708_034651 | 3300042652 | Bacteria | 10222 |
| 59 | Ga0466708_283509 | 3300042652 | Bacteria | 36560 |
| 60 | Ga0466727_261979 | 3300042655 | Bacteria | 2404 |
| 61 | Ga0466711_171381 | 3300042615 | Bacteria | 9311 |
| 62 | Ga0466711_238407 | 3300042615 | Bacteria | 19267 |
| 63 | Ga0466690_120487 | 3300042590 | Bacteria | 49787 |
| 64 | IMNBL1DRAFT_c0006722 | 3300000062 | Unclassified | 6224 |
| 65 | JGI24702J35022_10000812 | 3300002462 | Bacteria | 19310 |
| 66 | JGI24702J35022_10027202 | 3300002462 | Bacteria | 3077 |
| 67 | Ga0466705_058527 | 3300042612 | Unclassified | 6807 |
| 68 | Ga0466705_267995 | 3300042612 | Bacteria | 14205 |
| 69 | Ga0466733_028446 | 3300042659 | Bacteria | 1415 |
| 70 | Ga0466706_290038 | 3300042599 | Bacteria | 12734 |
| 71 | Ga0466707_155766 | 3300042601 | Bacteria | 11899 |
| 72 | Ga0466707_163091 | 3300042601 | Bacteria | 4348 |
| 73 | Ga0466716_109340 | 3300042605 | Bacteria | 13870 |
| 74 | Ga0466719_003688 | 3300042606 | Bacteria | 5836 |
| 75 | Ga0466704_093536 | 3300042643 | Bacteria | 7645 |
| 76 | Ga0466704_388102 | 3300042643 | Bacteria | 9893 |
| 77 | Ga0123357_10054822 | 3300009784 | Bacteria | 5372 |
| 78 | Ga0466715_033896 | 3300042616 | Bacteria | 4415 |
| 79 | Ga0466715_237264 | 3300042616 | Bacteria | 3961 |
| 80 | Ga0466715_604876 | 3300042616 | Bacteria | 36456 |
| 81 | Ga0466723_074520 | 3300042618 | Bacteria | 36085 |
| 82 | Ga0466723_089568 | 3300042618 | Bacteria | 54083 |
| 83 | Ga0466723_248982 | 3300042618 | Bacteria | 4462 |
| 84 | Ga0466728_448938 | 3300042620 | Bacteria | 10195 |
| 85 | Ga0466693_424275 | 3300042592 | Bacteria | 3340 |
| 86 | JGI24705J35276_12235740 | 3300002504 | Bacteria | 6917 |
| 87 | Ga0466705_145571 | 3300042612 | Bacteria | 4434 |
| 88 | Ga0466705_365057 | 3300042612 | Bacteria | 11803 |
| 89 | Ga0466707_210372 | 3300042601 | Bacteria | 12662 |
| 90 | Ga0466713_036270 | 3300042602 | Bacteria | 36906 |
| 91 | Ga0466714_114809 | 3300042603 | Bacteria | 1721 |
| 92 | Ga0466722_266178 | 3300042609 | Bacteria | 3291 |
| 93 | Ga0466731_228714 | 3300042622 | Bacteria | 2919 |
| 94 | Ga0466735_064782 | 3300042624 | Bacteria | 3430 |
| 95 | Ga0466711_365295 | 3300042615 | Bacteria | 2749 |
| 96 | Ga0466715_525875 | 3300042616 | Bacteria | 7148 |
| 97 | Ga0466726_048383 | 3300042619 | Bacteria | 29520 |
| 98 | Ga0466726_213518 | 3300042619 | Bacteria | 1754 |
| 99 | Ga0466705_074040 | 3300042612 | Bacteria | 4422 |
| 100 | Ga0466713_115337 | 3300042602 | Bacteria | 64305 |
| 101 | Ga0466716_354165 | 3300042605 | Bacteria | 8640 |
| 102 | Ga0466722_053718 | 3300042609 | Bacteria | 1738 |
| 103 | Ga0466735_078155 | 3300042624 | Bacteria | 8952 |
| 104 | Ga0466704_237712 | 3300042643 | Bacteria | 7600 |
| 105 | Ga0466708_095361 | 3300042652 | Bacteria | 44869 |
| 106 | Ga0466725_402399 | 3300042654 | Bacteria | 10607 |
| 107 | Ga0466723_072995 | 3300042618 | Bacteria | 71631 |
| 108 | Ga0466726_260724 | 3300042619 | Unclassified | 1525 |
| 109 | Ga0466726_368480 | 3300042619 | Bacteria | 1901 |
| 110 | Ga0466726_470728 | 3300042619 | Bacteria | 3406 |
| 111 | Ga0466728_447081 | 3300042620 | Bacteria | 2849 |
| 112 | Ga0466690_387937 | 3300042590 | Bacteria | 8988 |
| 113 | Ga0466696_196489 | 3300042596 | Bacteria | 1950 |
| 114 | Ga0068305_10052678 | 3300005083 | Bacteria | 5310 |
| 115 | Ga0068305_10163676 | 3300005083 | Unclassified | 3505 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01515 | PTA_PTB | Phosphate acetyl/butaryl transferase | 3 | 325 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01515 | GO:0016746 | acyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.