Protein Family IF05881
Metagenome
Metatranscriptome
Isolate
108
Members
38
Samples
103
Scaffolds
187.97
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_191583|Ga0466707_191583_6199_6771
- Length
- 174 aa
- Sequence
- MMARRIELPLTPELTATLRAGDAVALSGVIYTARDAAHKRFCELLDAGLPLPFDIRGATIYYAGPTPAAPGRVIGSVGPTTSYRMDAYAPRLLRADAVRETGAVYFGAVGGAGALLSECVKSSEVVAFDELGAEAVHRLVVEDFPAVVVIDSGGRNLYEEGRAAYLRSVAELSD
Sample Types
Isolate
4.6%
Metagenome
94.4%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
34.2%
Termitidae
28.9%
Rhinotermitidae
13.2%
Unclassified
10.5%
Termopsidae
7.9%
Stratiomyidae
2.6%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 19 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 25 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 26 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10667602 | 3300010049 | Bacteria | 1207 |
| 2 | Ga0466690_151426 | 3300042590 | Bacteria | 5501 |
| 3 | Ga0466692_038896 | 3300042591 | Bacteria | 28476 |
| 4 | Ga0466692_161449 | 3300042591 | Bacteria | 10345 |
| 5 | Ga0466691_220622 | 3300042593 | Bacteria | 26319 |
| 6 | Ga0466723_055980 | 3300042618 | Bacteria | 15225 |
| 7 | Ga0466703_094735 | 3300042636 | Bacteria | 23319 |
| 8 | Ga0466703_137337 | 3300042636 | Bacteria | 3180 |
| 9 | Ga0466704_344304 | 3300042643 | Bacteria | 5917 |
| 10 | Ga0466704_470499 | 3300042643 | Bacteria | 1878 |
| 11 | Ga0466727_327654 | 3300042655 | Bacteria | 1346 |
| 12 | Ga0466707_115598 | 3300042601 | Bacteria | 1271 |
| 13 | Ga0466707_191583 | 3300042601 | Bacteria | 10281 |
| 14 | Ga0466707_206150 | 3300042601 | Bacteria | 3167 |
| 15 | Ga0466717_016128 | 3300042604 | Bacteria | 1511 |
| 16 | Ga0466716_334140 | 3300042605 | Bacteria | 1306 |
| 17 | Ga0466720_067906 | 3300042607 | Bacteria | 18249 |
| 18 | Ga0123355_11058415 | 3300009826 | Bacteria | 851 |
| 19 | Ga0466690_057769 | 3300042590 | Bacteria | 1660 |
| 20 | Ga0466711_352913 | 3300042615 | Bacteria | 3219 |
| 21 | Ga0466715_362802 | 3300042616 | Bacteria | 2498 |
| 22 | Ga0466715_441505 | 3300042616 | Bacteria | 13792 |
| 23 | Ga0466726_171295 | 3300042619 | Bacteria | 2450 |
| 24 | Ga0466726_376914 | 3300042619 | Bacteria | 1077 |
| 25 | Ga0466704_164622 | 3300042643 | Bacteria | 6539 |
| 26 | Ga0466704_565468 | 3300042643 | Bacteria | 2387 |
| 27 | Ga0466727_133968 | 3300042655 | Bacteria | 3112 |
| 28 | Ga0466707_169266 | 3300042601 | Bacteria | 1404 |
| 29 | Ga0466722_019618 | 3300042609 | Bacteria | 14260 |
| 30 | Ga0466691_009241 | 3300042593 | Bacteria | 2642 |
| 31 | Ga0466711_288555 | 3300042615 | Bacteria | 2894 |
| 32 | Ga0466729_035822 | 3300042621 | Bacteria | 1656 |
| 33 | Ga0466735_138815 | 3300042624 | Bacteria | 1046 |
| 34 | Ga0466703_114568 | 3300042636 | Bacteria | 5961 |
| 35 | Ga0466703_197286 | 3300042636 | Bacteria | 21097 |
| 36 | Ga0466703_274241 | 3300042636 | Bacteria | 7659 |
| 37 | Ga0466707_210098 | 3300042601 | Bacteria | 23096 |
| 38 | JGI24702J35022_10000608 | 3300002462 | Bacteria | 21719 |
| 39 | Ga0072940_1363017 | 3300005200 | Bacteria | 2005 |
| 40 | Ga0466733_018973 | 3300042659 | Bacteria | 2578 |
| 41 | Ga0123355_10823889 | 3300009826 | Bacteria | 1028 |
| 42 | Ga0123353_10401705 | 3300010167 | Bacteria | 2039 |
| 43 | Ga0466691_097101 | 3300042593 | Bacteria | 3151 |
| 44 | Ga0466691_102983 | 3300042593 | Bacteria | 4197 |
| 45 | Ga0466696_038136 | 3300042596 | Bacteria | 24965 |
| 46 | Ga0466715_420090 | 3300042616 | Bacteria | 1517 |
| 47 | Ga0466715_580690 | 3300042616 | Bacteria | 5860 |
| 48 | Ga0466728_125333 | 3300042620 | Bacteria | 6574 |
| 49 | Ga0466728_293940 | 3300042620 | Bacteria | 3272 |
| 50 | Ga0466735_096071 | 3300042624 | Bacteria | 4290 |
| 51 | Ga0466703_174074 | 3300042636 | Bacteria | 1013 |
| 52 | Ga0466704_258918 | 3300042643 | Bacteria | 1679 |
| 53 | Ga0466707_088156 | 3300042601 | Bacteria | 5583 |
| 54 | Ga0466707_204075 | 3300042601 | Bacteria | 6141 |
| 55 | Ga0466719_118836 | 3300042606 | Bacteria | 5830 |
| 56 | Ga0123355_10454242 | 3300009826 | Bacteria | 1612 |
| 57 | Ga0466705_484536 | 3300042612 | Bacteria | 3551 |
| 58 | Ga0466711_160989 | 3300042615 | Bacteria | 1852 |
| 59 | Ga0466723_138267 | 3300042618 | Bacteria | 4230 |
| 60 | Ga0466723_238871 | 3300042618 | Bacteria | 2040 |
| 61 | Ga0466726_392595 | 3300042619 | Bacteria | 2490 |
| 62 | Ga0466703_253233 | 3300042636 | Bacteria | 2601 |
| 63 | Ga0466722_044244 | 3300042609 | Bacteria | 4116 |
| 64 | Ga0466722_063049 | 3300042609 | Bacteria | 8114 |
| 65 | Ga0466705_108340 | 3300042612 | Bacteria | 1344 |
| 66 | Ga0466705_244617 | 3300042612 | Bacteria | 23734 |
| 67 | Ga0466705_253916 | 3300042612 | Bacteria | 32036 |
| 68 | Ga0123357_10702157 | 3300009784 | Bacteria | 724 |
| 69 | Ga0456237_0013236 | 3300041968 | Bacteria | 1187 |
| 70 | Ga0466692_185265 | 3300042591 | Bacteria | 21279 |
| 71 | Ga0466715_489575 | 3300042616 | Bacteria | 2098 |
| 72 | Ga0466726_052739 | 3300042619 | Bacteria | 1479 |
| 73 | Ga0466704_218569 | 3300042643 | Bacteria | 14079 |
| 74 | Ga0466709_029656 | 3300042648 | Bacteria | 3528 |
| 75 | Ga0466706_271751 | 3300042599 | Bacteria | 1281 |
| 76 | Ga0466714_008116 | 3300042603 | Bacteria | 1442 |
| 77 | Ga0123353_10045611 | 3300010167 | Bacteria | 6958 |
| 78 | Ga0466691_061642 | 3300042593 | Bacteria | 11271 |
| 79 | Ga0466696_035678 | 3300042596 | Bacteria | 1208 |
| 80 | Ga0466711_431539 | 3300042615 | Bacteria | 2737 |
| 81 | Ga0466723_317041 | 3300042618 | Bacteria | 1933 |
| 82 | Ga0466728_385290 | 3300042620 | Bacteria | 44462 |
| 83 | Ga0466729_207463 | 3300042621 | Bacteria | 64397 |
| 84 | Ga0466703_020388 | 3300042636 | Bacteria | 11755 |
| 85 | Ga0466703_137551 | 3300042636 | Bacteria | 3674 |
| 86 | Ga0466722_072402 | 3300042609 | Bacteria | 1507 |
| 87 | Ga0466705_180766 | 3300042612 | Bacteria | 1904 |
| 88 | Ga0466705_367434 | 3300042612 | Bacteria | 38777 |
| 89 | Ga0466733_116478 | 3300042659 | Bacteria | 1693 |
| 90 | Ga0123357_10465583 | 3300009784 | Bacteria | 1082 |
| 91 | Ga0255809_1015635 | 3300022820 | Bacteria | 1295 |
| 92 | Ga0466690_197520 | 3300042590 | Bacteria | 6571 |
| 93 | Ga0466690_431370 | 3300042590 | Bacteria | 1203 |
| 94 | Ga0466691_194674 | 3300042593 | Bacteria | 5253 |
| 95 | Ga0466696_305521 | 3300042596 | Bacteria | 23613 |
| 96 | Ga0466696_446926 | 3300042596 | Bacteria | 40059 |
| 97 | Ga0466711_347463 | 3300042615 | Bacteria | 7887 |
| 98 | Ga0466726_448489 | 3300042619 | Bacteria | 4860 |
| 99 | Ga0466703_011664 | 3300042636 | Bacteria | 9112 |
| 100 | Ga0466703_083751 | 3300042636 | Unclassified | 2542 |
| 101 | Ga0466709_346744 | 3300042648 | Bacteria | 3100 |
| 102 | Ga0466706_003346 | 3300042599 | Bacteria | 1265 |
| 103 | Ga0466707_025376 | 3300042601 | Bacteria | 1023 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05683 | Fumerase_C | Fumarase C-terminus | 96 | 160 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF05683 | GO:0016836 | hydro-lyase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.