Protein Family IF05873

Metagenome Metatranscriptome Isolate
258 Members
188 Samples
137 Scaffolds
114.69 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_175608|Ga0466707_175608_5544_6005
Length
132 aa
Sequence
MQARAIAKNIGVTPRKARLIVDLVRGKAIEDAYAILENTNKSASLPVLKVIKSATANAVKNLNLKADDLFVKEIFVDEAIKMRRFLPRAKGSASGLVKRWSHITAVVSDEIGERKIKKAKVEPVVAEGKGAK

πŸ“Š Sample Types

Isolate 46.9%
Metagenome 52.7%
MAG 0.0%
Metatranscriptome 0.4%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 27.4%
Apidae 20.0%
Termitidae 12.0%
Kalotermitidae 7.4%
Drosophilidae 5.7%
Halictidae 5.1%
Tenebrionidae 4.6%
Formicidae 2.9%
Scarabaeidae 2.9%
Rhinotermitidae 2.3%
Termopsidae 2.3%
Passalidae 1.1%
Dytiscidae 1.1%
Hydrophilidae 0.6%
Libellulidae 0.6%
Gomphidae 0.6%
Cicadellidae 0.6%
Rhaphidophoridae 0.6%
Noctuidae 0.6%
Vespidae 0.6%
Bombycidae 0.6%
Hodotermitidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 238
Eukaryota 0
Viruses 0
Unclassified 20

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
2 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
3 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
4 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
5 2595698197 Melissococcus plutonius H6 Isolate Apidae
6 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
7 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
8 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
9 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
12 3300008519 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti Metagenome Formicidae
13 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
14 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
15 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
16 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
21 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
22 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
23 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
24 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
25 2627853628 Melissococcus plutonius 82 Isolate Apidae
26 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
27 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
28 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
29 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
30 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
31 8114555646 Enterococcus sp. DIV1094 Isolate
32 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
33 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
34 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
35 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
36 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
37 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
38 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
39 2595698195 Melissococcus plutonius 119 Isolate Apidae
40 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
41 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
42 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
43 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
44 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
45 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
48 8007223943 Enterococcus sp. MSG2901 Isolate
49 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
50 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
51 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
52 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
53 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
54 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
55 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
56 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
57 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
58 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
59 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
60 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
61 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
62 2595698198 Melissococcus plutonius L9 Isolate Apidae
63 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
64 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
65 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
66 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
67 2718218463 Candidatus Phytoplasma M3 Isolate Cicadellidae
68 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
69 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
70 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
71 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
72 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
73 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
74 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
75 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
76 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
77 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
78 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
79 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
80 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
81 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
82 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
83 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
84 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
85 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
86 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
87 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
88 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
89 2595698199 Melissococcus plutonius 60 Isolate Apidae
90 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
91 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
92 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
93 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
94 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
95 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
96 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
97 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
98 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
99 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
100 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
101 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
102 3004719924 Lactobacillus sp. W8174 Isolate Apidae
103 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
104 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
105 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
106 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
107 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
108 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
109 3300061801 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
110 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
111 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
112 8007237282 Enterococcus sp. DIV0212c Isolate
113 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
114 8017489919 Lactobacillus brevis EF Isolate Unclassified
115 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
116 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
117 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
118 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
119 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
120 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
121 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
122 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
123 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
124 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
125 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
126 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
127 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
128 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
129 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
130 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
131 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
132 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
133 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
134 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
135 8108568626 Enterococcus sp. DIV1094 Isolate
136 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
137 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
138 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
139 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
140 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
141 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
142 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
143 2595698193 Melissococcus plutonius B5 Isolate Apidae
144 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
145 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
146 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
147 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
148 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
149 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
150 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
151 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
152 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
153 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
154 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
155 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
156 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
157 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
158 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
159 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
160 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
161 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
162 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
163 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
164 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
165 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
166 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
167 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
168 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
169 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
170 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
171 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
172 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
173 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
174 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
175 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
176 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
177 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
178 2820471304 Unclassified Firmicutes Lab288P1bin89 Isolate Unclassified
179 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
180 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
181 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
182 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
183 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
184 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
185 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
186 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
187 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
188 8077780672 Enterococcus sp. PLM3 Isolate Formicidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0091 3300056790 Bacteria 324047
2 Ga0123355_10274230 3300009826 Bacteria 2338
3 Ga0123356_10030210 3300010049 Bacteria 5071
4 Ga0123353_10004369 3300010167 Bacteria 18194
5 Ga0466706_032791 3300042599 Bacteria 3728
6 Ga0466700_215031 3300042600 Bacteria 1501
7 Ga0466707_031260 3300042601 Bacteria 71521
8 Ga0466714_025045 3300042603 Bacteria 5162
9 HBC_ctgsDRAFT_1034216 3300000333 Unclassified 1248
10 JGI24697J35500_11113858 3300002507 Bacteria 1207
11 CVPL010L_1000082 3300002932 Bacteria 29431
12 Ga0068302_10000197 3300005071 Bacteria 28753
13 Ga0074278_148624 3300005721 Unclassified 1933
14 Ga0466715_357572 3300042616 Bacteria 181743
15 Ga0466696_011597 3300042596 Bacteria 4540
16 Ga0466735_023118 3300042624 Bacteria 12000
17 Ga0466704_199178 3300042643 Bacteria 10818
18 Ga0466708_419261 3300042652 Unclassified 3839
19 Ga0562379_0009 3300056790 Bacteria 1927879
20 Ga0562378_0004 3300056814 Bacteria 2423881
21 Ga0123355_10083911 3300009826 Bacteria 5076
22 Ga0123356_11562451 3300010049 Unclassified 816
23 Ga0123356_13841996 3300010049 Bacteria 518
24 Ga0466707_079941 3300042601 Bacteria 4479
25 Ga0466714_074012 3300042603 Bacteria 10127
26 HBC_ctgsDRAFT_1001649 3300000333 Unclassified 4895
27 JGI24702J35022_10069278 3300002462 Bacteria 1897
28 JGI24697J35500_11260002 3300002507 Unclassified 2953
29 Ga0068305_10009599 3300005083 Bacteria 20421
30 Ga0072940_1241986 3300005200 Bacteria 4194
31 Ga0466705_445586 3300042612 Bacteria 19081
32 Ga0466657_332912 3300042582 Bacteria 1934
33 Ga0466691_105136 3300042593 Bacteria 11830
34 Ga0466727_142534 3300042655 Bacteria 55597
35 Ga0123356_11570124 3300010049 Bacteria 814
36 Ga0123353_10074994 3300010167 Bacteria 5437
37 Ga0466706_015449 3300042599 Bacteria 1511
38 Ga0466713_104153 3300042602 Bacteria 73386
39 2227507956 2225789004 Bacteria 66298
40 Ga0104041_1120380 3300007106 Unclassified 1044
41 Ga0466711_473502 3300042615 Bacteria 1134
42 Ga0466715_224470 3300042616 Bacteria 60101
43 Ga0466715_301768 3300042616 Bacteria 11970
44 Ga0466715_453764 3300042616 Bacteria 6079
45 Ga0466718_088859 3300042617 Bacteria 1192
46 Ga0466726_353337 3300042619 Bacteria 59989
47 Ga0466728_289989 3300042620 Unclassified 2940
48 Ga0466693_114185 3300042592 Bacteria 1665
49 Ga0466734_028366 3300042623 Bacteria 3040
50 Ga0466709_052786 3300042648 Bacteria 2017
51 Ga0466733_010171 3300042659 Bacteria 4019
52 Ga0562379_1990 3300056790 Bacteria 19376
53 Ga0562375_0506 3300056856 Bacteria 80016
54 Ga0123356_10093969 3300010049 Bacteria 2863
55 Ga0123353_10095571 3300010167 Bacteria 4788
56 Ga0466700_023040 3300042600 Bacteria 7156
57 Ga0466707_025096 3300042601 Bacteria 11103
58 Ga0466719_014206 3300042606 Bacteria 3283
59 Ga0466719_274679 3300042606 Bacteria 3752
60 IMNBL1DRAFT_c0000511 3300000062 Bacteria 31936
61 HBC_ctgsDRAFT_1074271 3300000333 Unclassified 809
62 Ga0104147_1060604 3300007224 Bacteria 6184
63 Ga0466705_429575 3300042612 Bacteria 3984
64 Ga0255576_1000150 3300026558 Bacteria 47989
65 Ga0466703_236236 3300042636 Unclassified 1023
66 Ga0466703_275592 3300042636 Bacteria 11908
67 Ga0466703_306546 3300042636 Bacteria 3585
68 Ga0466703_327373 3300042636 Bacteria 22986
69 Ga0466708_420189 3300042652 Unclassified 3838
70 Ga0466713_143789 3300042602 Bacteria 39342
71 Ga0466717_021947 3300042604 Bacteria 25100
72 Ga0466722_240797 3300042609 Bacteria 12349
73 JGI24703J35330_11650699 3300002501 Unclassified 1596
74 JGI24703J35330_11729692 3300002501 Bacteria 2671
75 JGI24700J35501_10871056 3300002508 Unclassified 2253
76 Ga0074188_1178694 3300005318 Unclassified 706
77 Ga0074278_100321 3300005721 Bacteria 4684
78 Ga0466723_063787 3300042618 Bacteria 1664
79 Ga0466728_452942 3300042620 Bacteria 39308
80 Ga0466729_179085 3300042621 Bacteria 60360
81 Ga0466690_148542 3300042590 Bacteria 12801
82 Ga0466692_078337 3300042591 Bacteria 9721
83 Ga0466704_418829 3300042643 Bacteria 8884
84 Ga0466724_02361 3300042649 Bacteria 34785
85 Ga0562378_0008 3300056814 Bacteria 1370151
86 Ga0562376_0604 3300056857 Bacteria 61358
87 Ga0590791_17339 3300061801 Unclassified 543
88 Ga0123356_11996094 3300010049 Bacteria 723
89 Ga0466700_378389 3300042600 Bacteria 55739
90 Ga0466707_221470 3300042601 Bacteria 71824
91 Ga0466717_043303 3300042604 Bacteria 7032
92 IMNBL1DRAFT_c0000219 3300000062 Bacteria 50195
93 AustNasuHG_c1001775 3300000089 Bacteria 7810
94 Ga0068302_10003269 3300005071 Bacteria 26234
95 Ga0104045_1088118 3300007085 Bacteria 768
96 Ga0466715_464863 3300042616 Bacteria 1260
97 Ga0466728_148897 3300042620 Bacteria 5731
98 Ga0466696_092509 3300042596 Bacteria 3737
99 Ga0466734_119789 3300042623 Bacteria 17928
100 Ga0466735_005603 3300042624 Bacteria 13011
101 Ga0466702_002868 3300042635 Bacteria 60427
102 Ga0466705_246639 3300042612 Bacteria 4111
103 Ga0466705_279280 3300042612 Bacteria 14131
104 Ga0466732_212890 3300042656 Bacteria 1160
105 Ga0562379_0005 3300056790 Bacteria 2649770
106 Ga0562379_0410 3300056790 Bacteria 93813
107 Ga0562374_0016 3300057007 Bacteria 1205025
108 Ga0562374_0620 3300057007 Bacteria 54714
109 Ga0123356_10227480 3300010049 Bacteria 1927
110 Ga0123356_13363050 3300010049 Bacteria 556
111 Ga0123356_14120225 3300010049 Bacteria 500
112 Ga0123353_10505009 3300010167 Unclassified 1760
113 Ga0466706_156900 3300042599 Bacteria 13644
114 Ga0466700_041154 3300042600 Bacteria 59068
115 2227080773 2225789004 Bacteria 205580
116 Ga0052191_100638 3300003097 Bacteria 1901
117 Ga0072941_1012258 3300005201 Bacteria 37649
118 Ga0466692_201456 3300042591 Unclassified 1104
119 Ga0466696_280620 3300042596 Bacteria 1790
120 Ga0466704_435702 3300042643 Bacteria 9389
121 Ga0466724_11615 3300042649 Bacteria 6564
122 Ga0466697_241817 3300042611 Bacteria 1434
123 Ga0530661_000003 3300056564 Bacteria 462969
124 Ga0562379_0026 3300056790 Bacteria 801830
125 Ga0562374_0008 3300057007 Bacteria 1999653
126 Ga0466706_060468 3300042599 Bacteria 4408
127 Ga0466707_175608 3300042601 Bacteria 13441
128 2227266899 2225789004 Bacteria 6958
129 2227414123 2225789004 Bacteria 26621
130 Ga0105553_1026687 3300007767 Unclassified 11589
131 Ga0111037_105193 3300008519 Bacteria 11025
132 Ga0466715_051439 3300042616 Bacteria 8519
133 Ga0466729_156052 3300042621 Bacteria 12586
134 Ga0255575_1000023 3300026559 Bacteria 88290
135 Ga0466690_390876 3300042590 Unclassified 1071
136 Ga0466691_054986 3300042593 Bacteria 23619
137 Ga0466696_247313 3300042596 Unclassified 1415

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e 5 107 0.97

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.