Protein Family IF05873
Metagenome
Metatranscriptome
Isolate
258
Members
188
Samples
137
Scaffolds
114.69
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_175608|Ga0466707_175608_5544_6005
- Length
- 132 aa
- Sequence
- MQARAIAKNIGVTPRKARLIVDLVRGKAIEDAYAILENTNKSASLPVLKVIKSATANAVKNLNLKADDLFVKEIFVDEAIKMRRFLPRAKGSASGLVKRWSHITAVVSDEIGERKIKKAKVEPVVAEGKGAK
Sample Types
Isolate
46.9%
Metagenome
52.7%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
27.4%
Apidae
20.0%
Termitidae
12.0%
Kalotermitidae
7.4%
Drosophilidae
5.7%
Halictidae
5.1%
Tenebrionidae
4.6%
Formicidae
2.9%
Scarabaeidae
2.9%
Rhinotermitidae
2.3%
Termopsidae
2.3%
Passalidae
1.1%
Dytiscidae
1.1%
Hydrophilidae
0.6%
Libellulidae
0.6%
Gomphidae
0.6%
Cicadellidae
0.6%
Rhaphidophoridae
0.6%
Noctuidae
0.6%
Vespidae
0.6%
Bombycidae
0.6%
Hodotermitidae
0.6%
Taxonomy
Archaea
0
Bacteria
238
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 2 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 3 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 4 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 5 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 6 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 7 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 8 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 9 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 12 | 3300008519 | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Neivamyrmex summichrasti Gut microbial communities of Neivamyrmex summichrasti | Metagenome | Formicidae |
| 13 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 14 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 15 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 16 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 21 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 24 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 25 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 26 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 27 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 28 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 29 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 30 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 31 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 32 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 33 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 34 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 35 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 36 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 37 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 38 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 39 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 40 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 41 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 42 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 43 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 48 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 49 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 50 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 51 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 52 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 53 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 59 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 60 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 61 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 62 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 63 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 64 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 65 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 66 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 67 | 2718218463 | Candidatus Phytoplasma M3 | Isolate | Cicadellidae |
| 68 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 69 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 70 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 71 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 72 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 73 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 74 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 75 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 76 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 77 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 78 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 79 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 80 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 81 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 82 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 83 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 84 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 85 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 86 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 87 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 88 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 89 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 90 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 91 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 92 | 2756170272 | Convivina intestini DSM 28795 | Isolate | Unclassified |
| 93 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 94 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 95 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 96 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 97 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 98 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 99 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 100 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 101 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 102 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 103 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 104 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 105 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 106 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 107 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 108 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 109 | 3300061801 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_oats_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 110 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 111 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 112 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 113 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 114 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 115 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 116 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 117 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 118 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 119 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 120 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 121 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 122 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 123 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 124 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 125 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 126 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 127 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 128 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 129 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 130 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 131 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 132 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 133 | 3300026559 | Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 | Metagenome | Formicidae |
| 134 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 135 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 136 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 137 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 138 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 139 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 140 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 141 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 142 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 143 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 144 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 145 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 146 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 147 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 148 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 149 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 150 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 151 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 152 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 153 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 154 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 155 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 156 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 157 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 158 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 159 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 160 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 161 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 162 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 163 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 164 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 165 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 166 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 167 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 168 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 169 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 170 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 171 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 172 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 173 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 174 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 175 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 176 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 177 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 178 | 2820471304 | Unclassified Firmicutes Lab288P1bin89 | Isolate | Unclassified |
| 179 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 180 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 181 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 182 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 183 | 3300026558 | Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 | Metagenome | Formicidae |
| 184 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 185 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 186 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 187 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 188 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0091 | 3300056790 | Bacteria | 324047 |
| 2 | Ga0123355_10274230 | 3300009826 | Bacteria | 2338 |
| 3 | Ga0123356_10030210 | 3300010049 | Bacteria | 5071 |
| 4 | Ga0123353_10004369 | 3300010167 | Bacteria | 18194 |
| 5 | Ga0466706_032791 | 3300042599 | Bacteria | 3728 |
| 6 | Ga0466700_215031 | 3300042600 | Bacteria | 1501 |
| 7 | Ga0466707_031260 | 3300042601 | Bacteria | 71521 |
| 8 | Ga0466714_025045 | 3300042603 | Bacteria | 5162 |
| 9 | HBC_ctgsDRAFT_1034216 | 3300000333 | Unclassified | 1248 |
| 10 | JGI24697J35500_11113858 | 3300002507 | Bacteria | 1207 |
| 11 | CVPL010L_1000082 | 3300002932 | Bacteria | 29431 |
| 12 | Ga0068302_10000197 | 3300005071 | Bacteria | 28753 |
| 13 | Ga0074278_148624 | 3300005721 | Unclassified | 1933 |
| 14 | Ga0466715_357572 | 3300042616 | Bacteria | 181743 |
| 15 | Ga0466696_011597 | 3300042596 | Bacteria | 4540 |
| 16 | Ga0466735_023118 | 3300042624 | Bacteria | 12000 |
| 17 | Ga0466704_199178 | 3300042643 | Bacteria | 10818 |
| 18 | Ga0466708_419261 | 3300042652 | Unclassified | 3839 |
| 19 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 20 | Ga0562378_0004 | 3300056814 | Bacteria | 2423881 |
| 21 | Ga0123355_10083911 | 3300009826 | Bacteria | 5076 |
| 22 | Ga0123356_11562451 | 3300010049 | Unclassified | 816 |
| 23 | Ga0123356_13841996 | 3300010049 | Bacteria | 518 |
| 24 | Ga0466707_079941 | 3300042601 | Bacteria | 4479 |
| 25 | Ga0466714_074012 | 3300042603 | Bacteria | 10127 |
| 26 | HBC_ctgsDRAFT_1001649 | 3300000333 | Unclassified | 4895 |
| 27 | JGI24702J35022_10069278 | 3300002462 | Bacteria | 1897 |
| 28 | JGI24697J35500_11260002 | 3300002507 | Unclassified | 2953 |
| 29 | Ga0068305_10009599 | 3300005083 | Bacteria | 20421 |
| 30 | Ga0072940_1241986 | 3300005200 | Bacteria | 4194 |
| 31 | Ga0466705_445586 | 3300042612 | Bacteria | 19081 |
| 32 | Ga0466657_332912 | 3300042582 | Bacteria | 1934 |
| 33 | Ga0466691_105136 | 3300042593 | Bacteria | 11830 |
| 34 | Ga0466727_142534 | 3300042655 | Bacteria | 55597 |
| 35 | Ga0123356_11570124 | 3300010049 | Bacteria | 814 |
| 36 | Ga0123353_10074994 | 3300010167 | Bacteria | 5437 |
| 37 | Ga0466706_015449 | 3300042599 | Bacteria | 1511 |
| 38 | Ga0466713_104153 | 3300042602 | Bacteria | 73386 |
| 39 | 2227507956 | 2225789004 | Bacteria | 66298 |
| 40 | Ga0104041_1120380 | 3300007106 | Unclassified | 1044 |
| 41 | Ga0466711_473502 | 3300042615 | Bacteria | 1134 |
| 42 | Ga0466715_224470 | 3300042616 | Bacteria | 60101 |
| 43 | Ga0466715_301768 | 3300042616 | Bacteria | 11970 |
| 44 | Ga0466715_453764 | 3300042616 | Bacteria | 6079 |
| 45 | Ga0466718_088859 | 3300042617 | Bacteria | 1192 |
| 46 | Ga0466726_353337 | 3300042619 | Bacteria | 59989 |
| 47 | Ga0466728_289989 | 3300042620 | Unclassified | 2940 |
| 48 | Ga0466693_114185 | 3300042592 | Bacteria | 1665 |
| 49 | Ga0466734_028366 | 3300042623 | Bacteria | 3040 |
| 50 | Ga0466709_052786 | 3300042648 | Bacteria | 2017 |
| 51 | Ga0466733_010171 | 3300042659 | Bacteria | 4019 |
| 52 | Ga0562379_1990 | 3300056790 | Bacteria | 19376 |
| 53 | Ga0562375_0506 | 3300056856 | Bacteria | 80016 |
| 54 | Ga0123356_10093969 | 3300010049 | Bacteria | 2863 |
| 55 | Ga0123353_10095571 | 3300010167 | Bacteria | 4788 |
| 56 | Ga0466700_023040 | 3300042600 | Bacteria | 7156 |
| 57 | Ga0466707_025096 | 3300042601 | Bacteria | 11103 |
| 58 | Ga0466719_014206 | 3300042606 | Bacteria | 3283 |
| 59 | Ga0466719_274679 | 3300042606 | Bacteria | 3752 |
| 60 | IMNBL1DRAFT_c0000511 | 3300000062 | Bacteria | 31936 |
| 61 | HBC_ctgsDRAFT_1074271 | 3300000333 | Unclassified | 809 |
| 62 | Ga0104147_1060604 | 3300007224 | Bacteria | 6184 |
| 63 | Ga0466705_429575 | 3300042612 | Bacteria | 3984 |
| 64 | Ga0255576_1000150 | 3300026558 | Bacteria | 47989 |
| 65 | Ga0466703_236236 | 3300042636 | Unclassified | 1023 |
| 66 | Ga0466703_275592 | 3300042636 | Bacteria | 11908 |
| 67 | Ga0466703_306546 | 3300042636 | Bacteria | 3585 |
| 68 | Ga0466703_327373 | 3300042636 | Bacteria | 22986 |
| 69 | Ga0466708_420189 | 3300042652 | Unclassified | 3838 |
| 70 | Ga0466713_143789 | 3300042602 | Bacteria | 39342 |
| 71 | Ga0466717_021947 | 3300042604 | Bacteria | 25100 |
| 72 | Ga0466722_240797 | 3300042609 | Bacteria | 12349 |
| 73 | JGI24703J35330_11650699 | 3300002501 | Unclassified | 1596 |
| 74 | JGI24703J35330_11729692 | 3300002501 | Bacteria | 2671 |
| 75 | JGI24700J35501_10871056 | 3300002508 | Unclassified | 2253 |
| 76 | Ga0074188_1178694 | 3300005318 | Unclassified | 706 |
| 77 | Ga0074278_100321 | 3300005721 | Bacteria | 4684 |
| 78 | Ga0466723_063787 | 3300042618 | Bacteria | 1664 |
| 79 | Ga0466728_452942 | 3300042620 | Bacteria | 39308 |
| 80 | Ga0466729_179085 | 3300042621 | Bacteria | 60360 |
| 81 | Ga0466690_148542 | 3300042590 | Bacteria | 12801 |
| 82 | Ga0466692_078337 | 3300042591 | Bacteria | 9721 |
| 83 | Ga0466704_418829 | 3300042643 | Bacteria | 8884 |
| 84 | Ga0466724_02361 | 3300042649 | Bacteria | 34785 |
| 85 | Ga0562378_0008 | 3300056814 | Bacteria | 1370151 |
| 86 | Ga0562376_0604 | 3300056857 | Bacteria | 61358 |
| 87 | Ga0590791_17339 | 3300061801 | Unclassified | 543 |
| 88 | Ga0123356_11996094 | 3300010049 | Bacteria | 723 |
| 89 | Ga0466700_378389 | 3300042600 | Bacteria | 55739 |
| 90 | Ga0466707_221470 | 3300042601 | Bacteria | 71824 |
| 91 | Ga0466717_043303 | 3300042604 | Bacteria | 7032 |
| 92 | IMNBL1DRAFT_c0000219 | 3300000062 | Bacteria | 50195 |
| 93 | AustNasuHG_c1001775 | 3300000089 | Bacteria | 7810 |
| 94 | Ga0068302_10003269 | 3300005071 | Bacteria | 26234 |
| 95 | Ga0104045_1088118 | 3300007085 | Bacteria | 768 |
| 96 | Ga0466715_464863 | 3300042616 | Bacteria | 1260 |
| 97 | Ga0466728_148897 | 3300042620 | Bacteria | 5731 |
| 98 | Ga0466696_092509 | 3300042596 | Bacteria | 3737 |
| 99 | Ga0466734_119789 | 3300042623 | Bacteria | 17928 |
| 100 | Ga0466735_005603 | 3300042624 | Bacteria | 13011 |
| 101 | Ga0466702_002868 | 3300042635 | Bacteria | 60427 |
| 102 | Ga0466705_246639 | 3300042612 | Bacteria | 4111 |
| 103 | Ga0466705_279280 | 3300042612 | Bacteria | 14131 |
| 104 | Ga0466732_212890 | 3300042656 | Bacteria | 1160 |
| 105 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 106 | Ga0562379_0410 | 3300056790 | Bacteria | 93813 |
| 107 | Ga0562374_0016 | 3300057007 | Bacteria | 1205025 |
| 108 | Ga0562374_0620 | 3300057007 | Bacteria | 54714 |
| 109 | Ga0123356_10227480 | 3300010049 | Bacteria | 1927 |
| 110 | Ga0123356_13363050 | 3300010049 | Bacteria | 556 |
| 111 | Ga0123356_14120225 | 3300010049 | Bacteria | 500 |
| 112 | Ga0123353_10505009 | 3300010167 | Unclassified | 1760 |
| 113 | Ga0466706_156900 | 3300042599 | Bacteria | 13644 |
| 114 | Ga0466700_041154 | 3300042600 | Bacteria | 59068 |
| 115 | 2227080773 | 2225789004 | Bacteria | 205580 |
| 116 | Ga0052191_100638 | 3300003097 | Bacteria | 1901 |
| 117 | Ga0072941_1012258 | 3300005201 | Bacteria | 37649 |
| 118 | Ga0466692_201456 | 3300042591 | Unclassified | 1104 |
| 119 | Ga0466696_280620 | 3300042596 | Bacteria | 1790 |
| 120 | Ga0466704_435702 | 3300042643 | Bacteria | 9389 |
| 121 | Ga0466724_11615 | 3300042649 | Bacteria | 6564 |
| 122 | Ga0466697_241817 | 3300042611 | Bacteria | 1434 |
| 123 | Ga0530661_000003 | 3300056564 | Bacteria | 462969 |
| 124 | Ga0562379_0026 | 3300056790 | Bacteria | 801830 |
| 125 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 126 | Ga0466706_060468 | 3300042599 | Bacteria | 4408 |
| 127 | Ga0466707_175608 | 3300042601 | Bacteria | 13441 |
| 128 | 2227266899 | 2225789004 | Bacteria | 6958 |
| 129 | 2227414123 | 2225789004 | Bacteria | 26621 |
| 130 | Ga0105553_1026687 | 3300007767 | Unclassified | 11589 |
| 131 | Ga0111037_105193 | 3300008519 | Bacteria | 11025 |
| 132 | Ga0466715_051439 | 3300042616 | Bacteria | 8519 |
| 133 | Ga0466729_156052 | 3300042621 | Bacteria | 12586 |
| 134 | Ga0255575_1000023 | 3300026559 | Bacteria | 88290 |
| 135 | Ga0466690_390876 | 3300042590 | Unclassified | 1071 |
| 136 | Ga0466691_054986 | 3300042593 | Bacteria | 23619 |
| 137 | Ga0466696_247313 | 3300042596 | Unclassified | 1415 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00237 | Ribosomal_L22 | Ribosomal protein L22p/L17e | 5 | 107 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.