Protein Family IF05872

Metagenome Isolate
136 Members
66 Samples
114 Scaffolds
436.35 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_172705|Ga0466707_172705_2259_3599
Length
436 aa
Sequence
MQFYNRTREIEELNRIRELAFTDHSRMTVITGRRRIGKTSLIMKANEKTPTAYLFVGRKDEAALCGEFTDTVAKALNVFIPEGMHRFQVLFQYLMELAVRQPFTLVINEFQEFLTINPSVYHDMQYLWDQYKDRSRMHLILCGSVYSFMQKIFQDSQEPLFGRADNIIKLSAFDLETIKKIMKDHRPQYRNDELLALYAFTGGIPKYIELFCDNLNQSSDGLSIPGMIDFMIRDNSPFIEEGKYLLIEEFGKNYGGYFSILDAVAGGRTTQPEIAAALGDKSIGGQIKRLIEDYNILVRRRPVLAKEGTQAVRYEIADNFLQFWFNYFDRYRSMIEIKNFTGLRSIIKDDYTTYSGKILERYFRQQLAESQNYRDIGSWWETRGENQNEIDIVALGLEKNHALAVEVKRQREKYKPALLTLPGYEVEGRCLSLEDM

📊 Sample Types

Isolate 16.2%
Metagenome 83.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 30.3%
Termitidae 30.3%
Kalotermitidae 19.7%
Termopsidae 6.1%
Unclassified 4.5%
Rhinotermitidae 4.5%
Hodotermitidae 1.5%
Passalidae 1.5%
Hydrophilidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 1
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
3 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
4 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2920168565 Paludibacter sp. 221 Isolate Blattidae
15 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
16 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
17 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
24 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
27 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
28 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
29 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
30 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
31 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
32 3004672520 Bacteroides sp. 51 Isolate Blattidae
33 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
34 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
35 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
45 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
46 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
47 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
48 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
49 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
50 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
51 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
52 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
53 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
54 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
55 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
56 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
57 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
58 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
59 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
60 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
61 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
62 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
66 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_244044 3300042611 Bacteria 1490
2 Ga0466707_172705 3300042601 Bacteria 3662
3 Ga0466714_058811 3300042603 Bacteria 71979
4 Ga0466721_197278 3300042608 Bacteria 1605
5 Ga0123356_10059260 3300010049 Bacteria 3571
6 Ga0123353_10031860 3300010167 Unclassified 8177
7 Ga0123353_10422325 3300010167 Unclassified 1975
8 Ga0123354_10053155 3300010882 Bacteria 6094
9 Ga0466657_292293 3300042582 Bacteria 4048
10 Ga0466715_292976 3300042616 Bacteria 12514
11 Ga0466735_228782 3300042624 Bacteria 2355
12 JGI24702J35022_10007431 3300002462 Bacteria 6283
13 Ga0466705_053723 3300042612 Bacteria 8334
14 Ga0466733_047581 3300042659 Bacteria 2962
15 Ga0466701_017652 3300042598 Bacteria 77230
16 Ga0466701_084779 3300042598 Bacteria 2423
17 Ga0466707_255521 3300042601 Unclassified 1767
18 Ga0466716_048659 3300042605 Bacteria 9707
19 Ga0466690_297960 3300042590 Bacteria 5521
20 Ga0466696_008762 3300042596 Bacteria 3312
21 Ga0466705_508314 3300042612 Bacteria 2553
22 Ga0466711_287583 3300042615 Bacteria 8392
23 Ga0466715_122735 3300042616 Bacteria 32510
24 Ga0466728_287333 3300042620 Bacteria 2754
25 Ga0466702_270209 3300042635 Unclassified 1753
26 Ga0466703_033605 3300042636 Bacteria 2350
27 Ga0466703_087458 3300042636 Bacteria 3809
28 Ga0466703_105741 3300042636 Bacteria 30105
29 Ga0466704_384622 3300042643 Bacteria 22132
30 Ga0466724_28691 3300042649 Bacteria 3072
31 JGI24696J40584_12960120 3300002834 Bacteria 6378
32 Ga0466707_181127 3300042601 Bacteria 2368
33 Ga0466713_033316 3300042602 Bacteria 26536
34 Ga0466714_105470 3300042603 Bacteria 2489
35 Ga0466716_068617 3300042605 Bacteria 6727
36 Ga0123354_10207701 3300010882 Bacteria 2128
37 Ga0466693_160987 3300042592 Bacteria 2403
38 Ga0466723_154729 3300042618 Bacteria 50278
39 Ga0466703_087740 3300042636 Bacteria 7386
40 Ga0466704_129589 3300042643 Bacteria 4575
41 Ga0466707_258487 3300042601 Bacteria 6602
42 Ga0466719_069785 3300042606 Bacteria 4065
43 Ga0466722_026250 3300042609 Bacteria 4431
44 Ga0123356_10103793 3300010049 Bacteria 2731
45 Ga0123353_10301456 3300010167 Bacteria 2446
46 Ga0123354_10149974 3300010882 Bacteria 2831
47 Ga0466691_040020 3300042593 Bacteria 9351
48 Ga0466715_096934 3300042616 Bacteria 11349
49 Ga0466715_202904 3300042616 Bacteria 11500
50 Ga0466729_197161 3300042621 Bacteria 2126
51 Ga0466703_068288 3300042636 Bacteria 3448
52 Ga0466709_283978 3300042648 Bacteria 4247
53 JGI24702J35022_10035662 3300002462 Bacteria 2661
54 JGI24702J35022_10037324 3300002462 Bacteria 2595
55 JGI24702J35022_10079869 3300002462 Unclassified 1771
56 JGI24699J35502_11126011 3300002509 Bacteria 3888
57 Ga0068302_10033800 3300005071 Bacteria 1648
58 Ga0466732_099096 3300042656 Bacteria 1532
59 Ga0466700_051628 3300042600 Bacteria 8497
60 Ga0466714_123536 3300042603 Bacteria 5187
61 Ga0466714_157841 3300042603 Bacteria 3204
62 Ga0466719_239394 3300042606 Bacteria 3031
63 Ga0123357_10024995 3300009784 Bacteria 8052
64 Ga0123356_10461238 3300010049 Bacteria 1420
65 Ga0466657_247304 3300042582 Bacteria 3669
66 Ga0466711_118619 3300042615 Bacteria 1820
67 Ga0466715_208521 3300042616 Bacteria 1981
68 Ga0466735_185770 3300042624 Bacteria 1961
69 Ga0466703_212180 3300042636 Bacteria 10402
70 IMNBL1DRAFT_c0027108 3300000062 Bacteria 2162
71 JGI24702J35022_10002111 3300002462 Unclassified 12274
72 Ga0123357_10002599 3300009784 Bacteria 20282
73 Ga0466705_178017 3300042612 Bacteria 3635
74 Ga0466733_014001 3300042659 Bacteria 2705
75 Ga0466706_268073 3300042599 Bacteria 40014
76 Ga0466716_229849 3300042605 Bacteria 2247
77 Ga0466716_232518 3300042605 Bacteria 3153
78 Ga0466721_330412 3300042608 Bacteria 1913
79 Ga0123357_10063551 3300009784 Unclassified 4936
80 Ga0123354_10181986 3300010882 Bacteria 2395
81 Ga0466656_376811 3300042550 Bacteria 5165
82 Ga0466726_396743 3300042619 Bacteria 1516
83 Ga0466703_077477 3300042636 Bacteria 1878
84 Ga0466725_263588 3300042654 Bacteria 2143
85 Ga0466727_318977 3300042655 Bacteria 1352
86 Ga0466733_080740 3300042659 Unclassified 19613
87 Ga0466706_145766 3300042599 Bacteria 24432
88 Ga0466707_200988 3300042601 Bacteria 7366
89 Ga0466714_053539 3300042603 Bacteria 10165
90 Ga0466692_098259 3300042591 Bacteria 2861
91 Ga0466696_215996 3300042596 Bacteria 11564
92 Ga0466711_038275 3300042615 Bacteria 4911
93 Ga0466711_155661 3300042615 Bacteria 9809
94 Ga0466711_319527 3300042615 Bacteria 3082
95 Ga0466715_182843 3300042616 Bacteria 11913
96 Ga0466728_412808 3300042620 Bacteria 3313
97 Ga0466729_081457 3300042621 Bacteria 4896
98 Ga0466735_185208 3300042624 Bacteria 1734
99 Ga0466703_048675 3300042636 Bacteria 3476
100 Ga0466704_101389 3300042643 Bacteria 4643
101 Ga0466704_192714 3300042643 Bacteria 5136
102 IMNBL1DRAFT_c0001802 3300000062 Bacteria 15613
103 Ga0466733_086020 3300042659 Bacteria 11759
104 Ga0466706_018563 3300042599 Bacteria 2774
105 Ga0466706_029899 3300042599 Bacteria 7567
106 Ga0123353_10026284 3300010167 Unclassified 8888
107 Ga0123354_10177493 3300010882 Bacteria 2447
108 Ga0466690_408088 3300042590 Bacteria 2766
109 Ga0466692_101422 3300042591 Bacteria 32016
110 Ga0466696_373008 3300042596 Bacteria 7670
111 Ga0466715_576777 3300042616 Bacteria 11780
112 Ga0466703_041532 3300042636 Viruses 1891
113 Ga0466724_45380 3300042649 Bacteria 2792
114 JGI24702J35022_10017386 3300002462 Bacteria 3929

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_408088 Ga0466690_408088_28_1224 398
2 3300042598 Ga0466701_084779 Ga0466701_084779_98_1294 398
3 3300042605 Ga0466716_232518 Ga0466716_232518_1133_2329 398
4 3300042620 Ga0466728_412808 Ga0466728_412808_647_1843 398
5 3300042636 Ga0466703_105741 Ga0466703_105741_1896_3092 398
6 iso_pr_bacteria 2940209341 2940210874 398
7 3300005071 Ga0068302_10033800 Ga0068302_100338001 399
8 3300010049 Ga0123356_10461238 Ga0123356_104612382 399
9 3300042591 Ga0466692_098259 Ga0466692_098259_330_1574 414
10 3300042603 Ga0466714_157841 Ga0466714_157841_1924_3168 414
11 3300042582 Ga0466657_292293 Ga0466657_292293_11_1258 415
12 3300042608 Ga0466721_197278 Ga0466721_197278_316_1563 415
13 3300042636 Ga0466703_033605 Ga0466703_033605_597_1919 417
14 3300042655 Ga0466727_318977 Ga0466727_318977_25_1296 423
15 3300010882 Ga0123354_10053155 Ga0123354_100531552 424
16 3300010882 Ga0123354_10207701 Ga0123354_102077012 424
17 3300042619 Ga0466726_396743 Ga0466726_396743_17_1339 424
18 3300042624 Ga0466735_185208 Ga0466735_185208_113_1435 425
19 3300042615 Ga0466711_038275 Ga0466711_038275_3242_4573 428
20 3300042659 Ga0466733_047581 Ga0466733_047581_1380_2702 428
21 3300042582 Ga0466657_247304 Ga0466657_247304_546_1835 429
22 3300042599 Ga0466706_018563 Ga0466706_018563_488_1810 430
23 3300042643 Ga0466704_101389 Ga0466704_101389_3244_4536 430
24 3300002834 JGI24696J40584_12960120 JGI24696J40584_129601202 431
25 3300042596 Ga0466696_215996 Ga0466696_215996_8146_9468 431
26 3300042615 Ga0466711_319527 Ga0466711_319527_1440_2735 431
27 3300000062 IMNBL1DRAFT_c0001802 IMNBL1DRAFT_00018023 432
28 3300042616 Ga0466715_096934 Ga0466715_096934_9243_10637 432
29 3300042643 Ga0466704_384622 Ga0466704_384622_11888_13189 433
30 3300042601 Ga0466707_172705 Ga0466707_172705_2259_3599 436
31 3300042643 Ga0466704_129589 Ga0466704_129589_2876_4195 439
32 3300042590 Ga0466690_297960 Ga0466690_297960_1434_2756 440
33 3300042591 Ga0466692_101422 Ga0466692_101422_28701_30023 440
34 3300042592 Ga0466693_160987 Ga0466693_160987_803_2125 440
35 3300042596 Ga0466696_008762 Ga0466696_008762_1625_2947 440
36 3300042596 Ga0466696_373008 Ga0466696_373008_5934_7256 440
37 3300042598 Ga0466701_017652 Ga0466701_017652_34714_36036 440
38 3300042599 Ga0466706_029899 Ga0466706_029899_6197_7519 440
39 3300042599 Ga0466706_145766 Ga0466706_145766_3036_4358 440
40 3300042599 Ga0466706_268073 Ga0466706_268073_37197_38519 440
41 3300042600 Ga0466700_051628 Ga0466700_051628_3950_5272 440
42 3300042601 Ga0466707_181127 Ga0466707_181127_413_1735 440
43 3300042601 Ga0466707_200988 Ga0466707_200988_4258_5580 440
44 3300042601 Ga0466707_255521 Ga0466707_255521_253_1575 440
45 3300042601 Ga0466707_258487 Ga0466707_258487_3797_5119 440
46 3300042602 Ga0466713_033316 Ga0466713_033316_429_1751 440
47 3300042603 Ga0466714_053539 Ga0466714_053539_5165_6487 440
48 3300042603 Ga0466714_058811 Ga0466714_058811_53411_54733 440
49 3300042603 Ga0466714_105470 Ga0466714_105470_187_1509 440
50 3300042603 Ga0466714_123536 Ga0466714_123536_2184_3506 440
51 3300042605 Ga0466716_048659 Ga0466716_048659_312_1634 440
52 3300042605 Ga0466716_068617 Ga0466716_068617_356_1678 440
53 3300042606 Ga0466719_069785 Ga0466719_069785_1028_2350 440
54 3300042611 Ga0466697_244044 Ga0466697_244044_106_1428 440
55 3300042612 Ga0466705_178017 Ga0466705_178017_2217_3539 440
56 3300042612 Ga0466705_508314 Ga0466705_508314_299_1621 440
57 3300042615 Ga0466711_118619 Ga0466711_118619_331_1653 440
58 3300042615 Ga0466711_155661 Ga0466711_155661_398_1720 440
59 3300042615 Ga0466711_287583 Ga0466711_287583_3991_5313 440
60 3300042616 Ga0466715_182843 Ga0466715_182843_178_1500 440
61 3300042616 Ga0466715_292976 Ga0466715_292976_10740_12062 440
62 3300042616 Ga0466715_576777 Ga0466715_576777_10114_11436 440
63 3300042621 Ga0466729_081457 Ga0466729_081457_832_2154 440
64 3300042621 Ga0466729_197161 Ga0466729_197161_655_1977 440
65 3300042624 Ga0466735_228782 Ga0466735_228782_105_1427 440
66 3300042635 Ga0466702_270209 Ga0466702_270209_274_1596 440
67 3300042636 Ga0466703_048675 Ga0466703_048675_1468_2790 440
68 3300042636 Ga0466703_068288 Ga0466703_068288_398_1720 440
69 3300042636 Ga0466703_077477 Ga0466703_077477_538_1860 440
70 3300042636 Ga0466703_087740 Ga0466703_087740_5781_7103 440
71 3300042636 Ga0466703_212180 Ga0466703_212180_3028_4350 440
72 3300042648 Ga0466709_283978 Ga0466709_283978_323_1645 440
73 3300042649 Ga0466724_28691 Ga0466724_28691_1700_3022 440
74 3300042649 Ga0466724_45380 Ga0466724_45380_450_1772 440
75 3300042654 Ga0466725_263588 Ga0466725_263588_142_1464 440
76 3300042656 Ga0466732_099096 Ga0466732_099096_93_1415 440
77 3300042659 Ga0466733_014001 Ga0466733_014001_207_1529 440
78 3300042659 Ga0466733_080740 Ga0466733_080740_1138_2460 440
79 3300042659 Ga0466733_086020 Ga0466733_086020_4584_5906 440
80 iso_pr_bacteria 2820759988 2820760048 440
81 iso_pr_bacteria 2873600114 2873600119 440
82 iso_pr_bacteria 2910942425 2910942789 440
83 iso_pr_bacteria 2920168565 2920170277 440
84 iso_pr_bacteria 2940205530 2940209227 440
85 iso_pr_bacteria 2940212447 2940216126 440
86 iso_pr_bacteria 2940244548 2940248500 440
87 iso_pr_bacteria 2940248789 2940252638 440
88 iso_pr_bacteria 2940253009 2940256859 440
89 iso_pr_bacteria 2940257232 2940261000 440
90 iso_pr_bacteria 2940298504 2940302194 440
91 iso_pr_bacteria 2940302308 2940305952 440
92 iso_pr_bacteria 2940306115 2940309602 440
93 iso_pr_bacteria 2940309933 2940313438 440
94 iso_pr_bacteria 2940313741 2940317253 440
95 iso_pr_bacteria 2940317558 2940321011 440
96 iso_pr_bacteria 2940321370 2940324768 440
97 iso_pr_bacteria 2940325180 2940328822 440
98 iso_pr_bacteria 2940328985 2940332650 440
99 iso_pr_bacteria 2940332795 2940336304 440
100 iso_pr_bacteria 3004672520 3004672553 440
101 3300000062 IMNBL1DRAFT_c0027108 IMNBL1DRAFT_00271081 441
102 3300002462 JGI24702J35022_10002111 JGI24702J35022_100021114 441
103 3300002462 JGI24702J35022_10007431 JGI24702J35022_100074312 441
104 3300002462 JGI24702J35022_10017386 JGI24702J35022_100173864 441
105 3300002462 JGI24702J35022_10035662 JGI24702J35022_100356622 441
106 3300002462 JGI24702J35022_10037324 JGI24702J35022_100373242 441
107 3300002462 JGI24702J35022_10079869 JGI24702J35022_100798692 441
108 3300002509 JGI24699J35502_11126011 JGI24699J35502_111260113 441
109 3300010049 Ga0123356_10059260 Ga0123356_100592602 441
110 3300010049 Ga0123356_10103793 Ga0123356_101037932 441
111 3300010167 Ga0123353_10026284 Ga0123353_100262844 441
112 3300010167 Ga0123353_10031860 Ga0123353_1003186011 441
113 3300010167 Ga0123353_10301456 Ga0123353_103014563 441
114 3300010167 Ga0123353_10422325 Ga0123353_104223252 441
115 3300010882 Ga0123354_10149974 Ga0123354_101499742 441
116 3300010882 Ga0123354_10177493 Ga0123354_101774932 441
117 3300042608 Ga0466721_330412 Ga0466721_330412_65_1390 441
118 3300042609 Ga0466722_026250 Ga0466722_026250_1677_3002 441
119 3300042636 Ga0466703_041532 Ga0466703_041532_220_1638 441
120 3300009784 Ga0123357_10002599 Ga0123357_1000259911 442
121 3300009784 Ga0123357_10024995 Ga0123357_100249953 442
122 3300009784 Ga0123357_10063551 Ga0123357_100635515 442
123 3300010882 Ga0123354_10181986 Ga0123354_101819862 442
124 3300042550 Ga0466656_376811 Ga0466656_376811_3406_4734 442
125 3300042618 Ga0466723_154729 Ga0466723_154729_190_1518 442
126 3300042593 Ga0466691_040020 Ga0466691_040020_6172_7506 444
127 3300042605 Ga0466716_229849 Ga0466716_229849_424_1758 444
128 3300042612 Ga0466705_053723 Ga0466705_053723_2743_4077 444
129 3300042616 Ga0466715_202904 Ga0466715_202904_8856_10190 444
130 3300042616 Ga0466715_208521 Ga0466715_208521_496_1830 444
131 3300042620 Ga0466728_287333 Ga0466728_287333_718_2052 444
132 3300042643 Ga0466704_192714 Ga0466704_192714_2190_3524 444
133 3300042624 Ga0466735_185770 Ga0466735_185770_228_1601 445
134 3300042616 Ga0466715_122735 Ga0466715_122735_19614_20984 456
135 3300042636 Ga0466703_087458 Ga0466703_087458_1730_3106 458
136 3300042606 Ga0466719_239394 Ga0466719_239394_1323_2858 494

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03008 DUF234 Archaea bacterial proteins of unknown function 324 411 0.91
PF01637 ATPase_2 ATPase domain predominantly from Archaea 3 210 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01637 GO:0005524 ATP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.