Protein Family IF05869
Metagenome
Isolate
156
Members
58
Samples
151
Scaffolds
106.51
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_169701|Ga0466707_169701_251_562
- Length
- 103 aa
- Sequence
- MSKLHIKKGDNVIVIAGNGKSDKPRRVLEVIPDKQRAIVEGVNLVSKATKPNAKSPQGGVVKKEAPVHISNLNLADPKTGKPTRVGRRLNDEGKLVRYSKKSG
Sample Types
Isolate
3.2%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.9%
Kalotermitidae
24.6%
Unclassified
10.5%
Termopsidae
7.0%
Rhinotermitidae
5.3%
Passalidae
3.5%
Blattidae
3.5%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
148
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 39 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 40 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 41 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 44 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 45 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 46 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 47 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 52 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 53 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 54 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 55 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 56 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 57 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 58 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10001369 | 3300009826 | Bacteria | 33944 |
| 2 | Ga0466657_106830 | 3300042582 | Bacteria | 4958 |
| 3 | Ga0466692_188243 | 3300042591 | Bacteria | 86416 |
| 4 | Ga0466694_169767 | 3300042594 | Bacteria | 3131 |
| 5 | Ga0466706_249921 | 3300042599 | Bacteria | 1899 |
| 6 | Ga0466725_286288 | 3300042654 | Bacteria | 3552 |
| 7 | Ga0466715_140428 | 3300042616 | Unclassified | 3718 |
| 8 | Ga0466715_393072 | 3300042616 | Bacteria | 2173 |
| 9 | Ga0466723_196307 | 3300042618 | Bacteria | 2425 |
| 10 | Ga0466723_198099 | 3300042618 | Bacteria | 9283 |
| 11 | Ga0466729_097687 | 3300042621 | Bacteria | 1852 |
| 12 | Ga0466697_159296 | 3300042611 | Bacteria | 2288 |
| 13 | Ga0466733_042705 | 3300042659 | Bacteria | 1104 |
| 14 | Ga0123357_10224022 | 3300009784 | Bacteria | 2079 |
| 15 | Ga0123353_10510664 | 3300010167 | Bacteria | 1747 |
| 16 | Ga0123354_10001124 | 3300010882 | Bacteria | 31160 |
| 17 | Ga0123354_10335090 | 3300010882 | Bacteria | 1373 |
| 18 | Ga0466690_085991 | 3300042590 | Bacteria | 12516 |
| 19 | Ga0466692_137912 | 3300042591 | Bacteria | 2313 |
| 20 | Ga0466692_149579 | 3300042591 | Bacteria | 83669 |
| 21 | Ga0466691_024160 | 3300042593 | Bacteria | 6435 |
| 22 | Ga0466691_037573 | 3300042593 | Bacteria | 71526 |
| 23 | Ga0466691_127895 | 3300042593 | Bacteria | 14435 |
| 24 | Ga0466701_072879 | 3300042598 | Bacteria | 1441 |
| 25 | Ga0466707_190959 | 3300042601 | Bacteria | 10157 |
| 26 | Ga0466717_104945 | 3300042604 | Bacteria | 7422 |
| 27 | Ga0466717_112943 | 3300042604 | Bacteria | 2764 |
| 28 | Ga0466698_010047 | 3300042610 | Bacteria | 2975 |
| 29 | JGI24705J35276_12223229 | 3300002504 | Bacteria | 2489 |
| 30 | Ga0466730_081474 | 3300042625 | Bacteria | 2650 |
| 31 | Ga0466709_124093 | 3300042648 | Bacteria | 6162 |
| 32 | Ga0466708_050057 | 3300042652 | Bacteria | 16124 |
| 33 | Ga0466711_306949 | 3300042615 | Bacteria | 7933 |
| 34 | Ga0466715_487149 | 3300042616 | Bacteria | 11128 |
| 35 | Ga0466733_127261 | 3300042659 | Bacteria | 9314 |
| 36 | Ga0466733_150203 | 3300042659 | Unclassified | 1175 |
| 37 | Ga0123356_10425648 | 3300010049 | Bacteria | 1471 |
| 38 | Ga0466690_168212 | 3300042590 | Bacteria | 11803 |
| 39 | Ga0466692_027982 | 3300042591 | Bacteria | 60830 |
| 40 | Ga0466692_126414 | 3300042591 | Bacteria | 5610 |
| 41 | Ga0466692_144683 | 3300042591 | Bacteria | 28602 |
| 42 | Ga0466693_337571 | 3300042592 | Bacteria | 1083 |
| 43 | Ga0466701_003414 | 3300042598 | Bacteria | 1520 |
| 44 | Ga0466700_224480 | 3300042600 | Bacteria | 5875 |
| 45 | Ga0466700_425432 | 3300042600 | Bacteria | 1288 |
| 46 | Ga0466707_152952 | 3300042601 | Bacteria | 15357 |
| 47 | Ga0466707_169701 | 3300042601 | Bacteria | 1652 |
| 48 | Ga0466719_246425 | 3300042606 | Bacteria | 1533 |
| 49 | JGI24702J35022_10022268 | 3300002462 | Bacteria | 3432 |
| 50 | JGI24699J35502_10489986 | 3300002509 | Bacteria | 610 |
| 51 | Ga0068302_10404312 | 3300005071 | Bacteria | 525 |
| 52 | Ga0466734_065219 | 3300042623 | Bacteria | 1646 |
| 53 | Ga0466735_041724 | 3300042624 | Bacteria | 21992 |
| 54 | Ga0466735_114961 | 3300042624 | Bacteria | 12299 |
| 55 | Ga0466710_181922 | 3300042613 | Bacteria | 1424 |
| 56 | Ga0466715_177481 | 3300042616 | Bacteria | 2505 |
| 57 | Ga0466723_023434 | 3300042618 | Bacteria | 4582 |
| 58 | Ga0466728_275974 | 3300042620 | Bacteria | 7986 |
| 59 | Ga0466732_251622 | 3300042656 | Bacteria | 1657 |
| 60 | Ga0123356_11437600 | 3300010049 | Bacteria | 849 |
| 61 | Ga0123356_12800590 | 3300010049 | Bacteria | 610 |
| 62 | Ga0123353_10019531 | 3300010167 | Bacteria | 10075 |
| 63 | Ga0123353_11102558 | 3300010167 | Bacteria | 1054 |
| 64 | Ga0123354_10000498 | 3300010882 | Bacteria | 39457 |
| 65 | Ga0466692_138892 | 3300042591 | Bacteria | 2469 |
| 66 | Ga0466707_230802 | 3300042601 | Bacteria | 16904 |
| 67 | Ga0466697_037629 | 3300042611 | Bacteria | 1079 |
| 68 | JGI24695J34938_10021047 | 3300002450 | Bacteria | 3199 |
| 69 | JGI24705J35276_12113010 | 3300002504 | Bacteria | 1049 |
| 70 | JGI24696J40584_12942259 | 3300002834 | Bacteria | 1735 |
| 71 | Ga0466703_269865 | 3300042636 | Bacteria | 9316 |
| 72 | Ga0466704_134293 | 3300042643 | Bacteria | 13368 |
| 73 | Ga0466711_248608 | 3300042615 | Bacteria | 5371 |
| 74 | Ga0466715_595690 | 3300042616 | Bacteria | 7812 |
| 75 | Ga0466715_608206 | 3300042616 | Bacteria | 31747 |
| 76 | Ga0466723_021865 | 3300042618 | Bacteria | 3511 |
| 77 | Ga0466697_171567 | 3300042611 | Bacteria | 2992 |
| 78 | Ga0123356_10531087 | 3300010049 | Bacteria | 1336 |
| 79 | Ga0123356_11220021 | 3300010049 | Bacteria | 918 |
| 80 | Ga0123354_10450728 | 3300010882 | Bacteria | 1042 |
| 81 | Ga0466690_088011 | 3300042590 | Bacteria | 17371 |
| 82 | Ga0466700_021305 | 3300042600 | Bacteria | 30578 |
| 83 | Ga0466700_362329 | 3300042600 | Bacteria | 1992 |
| 84 | Ga0466707_029987 | 3300042601 | Bacteria | 4781 |
| 85 | Ga0466707_098650 | 3300042601 | Bacteria | 10173 |
| 86 | Ga0466722_076669 | 3300042609 | Bacteria | 1074 |
| 87 | Ga0466697_019506 | 3300042611 | Unclassified | 1161 |
| 88 | 2227491320 | 2225789004 | Bacteria | 4075 |
| 89 | IMNBL1DRAFT_c0105019 | 3300000062 | Bacteria | 755 |
| 90 | JGI24702J35022_10015605 | 3300002462 | Bacteria | 4175 |
| 91 | JGI24705J35276_12205817 | 3300002504 | Bacteria | 1706 |
| 92 | JGI24705J35276_12230277 | 3300002504 | Bacteria | 3586 |
| 93 | Ga0466734_132826 | 3300042623 | Unclassified | 1364 |
| 94 | Ga0466735_080555 | 3300042624 | Bacteria | 12371 |
| 95 | Ga0466735_171332 | 3300042624 | Unclassified | 1182 |
| 96 | Ga0466703_048228 | 3300042636 | Unclassified | 1446 |
| 97 | Ga0466703_095709 | 3300042636 | Bacteria | 3671 |
| 98 | Ga0466727_209714 | 3300042655 | Bacteria | 2537 |
| 99 | Ga0466726_013269 | 3300042619 | Bacteria | 5620 |
| 100 | Ga0466726_024142 | 3300042619 | Bacteria | 22843 |
| 101 | Ga0123357_10068381 | 3300009784 | Bacteria | 4725 |
| 102 | Ga0123356_13370890 | 3300010049 | Bacteria | 555 |
| 103 | Ga0123353_10427318 | 3300010167 | Bacteria | 1960 |
| 104 | Ga0123354_10006670 | 3300010882 | Bacteria | 17209 |
| 105 | Ga0123354_10030493 | 3300010882 | Bacteria | 8468 |
| 106 | Ga0466690_386221 | 3300042590 | Bacteria | 3339 |
| 107 | Ga0466694_059218 | 3300042594 | Bacteria | 1256 |
| 108 | Ga0466699_289834 | 3300042597 | Bacteria | 2314 |
| 109 | Ga0466701_062974 | 3300042598 | Bacteria | 2032 |
| 110 | Ga0466706_081547 | 3300042599 | Bacteria | 1228 |
| 111 | Ga0466707_012616 | 3300042601 | Bacteria | 2473 |
| 112 | Ga0466707_021229 | 3300042601 | Bacteria | 1716 |
| 113 | Ga0466707_031655 | 3300042601 | Bacteria | 2932 |
| 114 | Ga0466713_090124 | 3300042602 | Bacteria | 2135 |
| 115 | Ga0466719_035836 | 3300042606 | Unclassified | 3324 |
| 116 | Ga0466719_554685 | 3300042606 | Bacteria | 12056 |
| 117 | Ga0068305_10043866 | 3300005083 | Bacteria | 3860 |
| 118 | Ga0466735_069412 | 3300042624 | Bacteria | 1697 |
| 119 | Ga0466730_053826 | 3300042625 | Bacteria | 92011 |
| 120 | Ga0466727_064420 | 3300042655 | Bacteria | 3976 |
| 121 | Ga0466697_085757 | 3300042611 | Bacteria | 2345 |
| 122 | Ga0123356_10043500 | 3300010049 | Unclassified | 4182 |
| 123 | Ga0123353_13148289 | 3300010167 | Bacteria | 530 |
| 124 | Ga0466696_042641 | 3300042596 | Bacteria | 3689 |
| 125 | Ga0466696_258054 | 3300042596 | Bacteria | 5053 |
| 126 | Ga0466701_076197 | 3300042598 | Bacteria | 1866 |
| 127 | Ga0466716_141317 | 3300042605 | Bacteria | 3572 |
| 128 | JGI24705J35276_12230458 | 3300002504 | Bacteria | 3635 |
| 129 | JGI24696J40584_12728214 | 3300002834 | Bacteria | 767 |
| 130 | Ga0466735_008034 | 3300042624 | Bacteria | 5195 |
| 131 | Ga0466735_083736 | 3300042624 | Bacteria | 2398 |
| 132 | Ga0466735_180421 | 3300042624 | Bacteria | 2530 |
| 133 | Ga0466704_182669 | 3300042643 | Bacteria | 4382 |
| 134 | Ga0466710_417764 | 3300042613 | Bacteria | 1019 |
| 135 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 136 | Ga0466726_430126 | 3300042619 | Bacteria | 2064 |
| 137 | Ga0466705_375992 | 3300042612 | Bacteria | 6956 |
| 138 | Ga0123357_10030639 | 3300009784 | Bacteria | 7293 |
| 139 | Ga0123355_10586018 | 3300009826 | Bacteria | 1330 |
| 140 | Ga0123356_10235985 | 3300010049 | Bacteria | 1896 |
| 141 | Ga0123353_11496921 | 3300010167 | Bacteria | 860 |
| 142 | Ga0466693_016100 | 3300042592 | Bacteria | 1178 |
| 143 | Ga0466722_076303 | 3300042609 | Bacteria | 1064 |
| 144 | Ga0466722_217034 | 3300042609 | Bacteria | 2782 |
| 145 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 146 | IMNBL1DRAFT_c0037352 | 3300000062 | Bacteria | 1684 |
| 147 | Ga0072941_1102373 | 3300005201 | Bacteria | 3441 |
| 148 | Ga0466734_073193 | 3300042623 | Bacteria | 1006 |
| 149 | Ga0466709_118201 | 3300042648 | Bacteria | 25211 |
| 150 | Ga0466727_069736 | 3300042655 | Bacteria | 1234 |
| 151 | Ga0466727_229366 | 3300042655 | Bacteria | 3254 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF17136 | ribosomal_L24 | Ribosomal proteins 50S L24/mitochondrial 39S L24 | 42 | 103 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.