Protein Family IF05844
Metagenome
Isolate
208
Members
77
Samples
180
Scaffolds
227.14
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_137259|Ga0466707_137259_561_1346
- Length
- 261 aa
- Sequence
- MRKVVVRKAPERTLRTAFFSNFPDMEIIYEDNHLIAVNKNCHEIVQGDKTGDIPLPEMLKEWLKEKYAKPGNVFAGVIHRLDRPVTGAVVFAKTSKALQRMNEKFRLGEVKKNYWAIVKNNPPEPEGELIHWLVRNEKQNKSFAYDAEKPGAKQAILHYRLIAQSERYFLLEIDLKTGRHHQIRCQLAKIGCPVKGDLKYGADRSNPDGGISLHARSISFLHPVTRQPVRLVAPVPGDTLWQALAESVPVHPDETLSPEKP
Sample Types
Isolate
13.5%
Metagenome
86.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
26.0%
Blattidae
23.4%
Kalotermitidae
18.2%
Unclassified
10.4%
Termopsidae
5.2%
Rhinotermitidae
3.9%
Tenebrionidae
2.6%
Drosophilidae
2.6%
Elmidae
2.6%
Passalidae
2.6%
Hodotermitidae
1.3%
Hydrophilidae
1.3%
Taxonomy
Archaea
0
Bacteria
206
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 2 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 19 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 20 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 21 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 28 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 34 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 35 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 36 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 43 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 44 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 51 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 52 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 53 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 54 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 55 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 56 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 57 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 58 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 59 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 60 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 61 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 62 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 63 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 64 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 65 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 66 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 67 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 68 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 69 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 70 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 71 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 72 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 73 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 74 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 75 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 76 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 77 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_025047 | 3300042599 | Bacteria | 5815 |
| 2 | Ga0466706_086623 | 3300042599 | Bacteria | 12385 |
| 3 | Ga0466707_261326 | 3300042601 | Bacteria | 4883 |
| 4 | Ga0466713_063067 | 3300042602 | Bacteria | 116971 |
| 5 | Ga0466719_133232 | 3300042606 | Bacteria | 3179 |
| 6 | Ga0466722_264474 | 3300042609 | Bacteria | 1543 |
| 7 | Ga0466710_304970 | 3300042613 | Bacteria | 1117 |
| 8 | Ga0466723_005723 | 3300042618 | Bacteria | 7983 |
| 9 | Ga0466726_026154 | 3300042619 | Bacteria | 9851 |
| 10 | Ga0466728_360258 | 3300042620 | Bacteria | 5803 |
| 11 | Ga0123357_10052147 | 3300009784 | Bacteria | 5525 |
| 12 | Ga0466704_055670 | 3300042643 | Bacteria | 9312 |
| 13 | Ga0466704_268159 | 3300042643 | Bacteria | 10201 |
| 14 | Ga0466709_330726 | 3300042648 | Bacteria | 8260 |
| 15 | Ga0466708_440707 | 3300042652 | Bacteria | 7881 |
| 16 | Ga0466690_241728 | 3300042590 | Bacteria | 1122 |
| 17 | Ga0466690_351619 | 3300042590 | Bacteria | 10399 |
| 18 | Ga0466692_104727 | 3300042591 | Bacteria | 1095 |
| 19 | Ga0466691_222548 | 3300042593 | Bacteria | 20111 |
| 20 | Ga0466696_096834 | 3300042596 | Bacteria | 8275 |
| 21 | Ga0466696_274194 | 3300042596 | Bacteria | 9483 |
| 22 | 2227241906 | 2225789004 | Bacteria | 7231 |
| 23 | IMNBL1DRAFT_c0002018 | 3300000062 | Bacteria | 14545 |
| 24 | JGI24702J35022_10012760 | 3300002462 | Bacteria | 4663 |
| 25 | Ga0068305_10228752 | 3300005083 | Bacteria | 2650 |
| 26 | Ga0104019_1193940 | 3300007150 | Bacteria | 1383 |
| 27 | Ga0466705_370120 | 3300042612 | Bacteria | 6275 |
| 28 | Ga0466706_140997 | 3300042599 | Bacteria | 4928 |
| 29 | Ga0466700_039627 | 3300042600 | Bacteria | 11016 |
| 30 | Ga0466707_284882 | 3300042601 | Bacteria | 17288 |
| 31 | Ga0466713_013942 | 3300042602 | Bacteria | 36823 |
| 32 | Ga0466713_145405 | 3300042602 | Bacteria | 30268 |
| 33 | Ga0466714_088011 | 3300042603 | Bacteria | 41067 |
| 34 | Ga0466716_033986 | 3300042605 | Bacteria | 1306 |
| 35 | Ga0466719_113260 | 3300042606 | Bacteria | 1013 |
| 36 | Ga0466722_239940 | 3300042609 | Bacteria | 60486 |
| 37 | Ga0466722_242007 | 3300042609 | Bacteria | 3724 |
| 38 | Ga0466698_383983 | 3300042610 | Bacteria | 1182 |
| 39 | Ga0466711_303779 | 3300042615 | Bacteria | 18039 |
| 40 | Ga0466711_373737 | 3300042615 | Bacteria | 78112 |
| 41 | Ga0466715_498734 | 3300042616 | Bacteria | 4309 |
| 42 | Ga0466715_594337 | 3300042616 | Bacteria | 3791 |
| 43 | Ga0466723_085797 | 3300042618 | Bacteria | 6260 |
| 44 | Ga0466726_193560 | 3300042619 | Bacteria | 1311 |
| 45 | Ga0123354_10020792 | 3300010882 | Bacteria | 10331 |
| 46 | Ga0123354_10044892 | 3300010882 | Bacteria | 6770 |
| 47 | Ga0466703_150695 | 3300042636 | Bacteria | 7729 |
| 48 | Ga0466709_363785 | 3300042648 | Bacteria | 41688 |
| 49 | Ga0466696_313177 | 3300042596 | Bacteria | 11374 |
| 50 | 2227228038 | 2225789004 | Bacteria | 7376 |
| 51 | 2227520197 | 2225789004 | Bacteria | 3357 |
| 52 | IMNBL1DRAFT_c0089890 | 3300000062 | Bacteria | 843 |
| 53 | JGI24702J35022_10002991 | 3300002462 | Bacteria | 10230 |
| 54 | JGI24702J35022_10040189 | 3300002462 | Bacteria | 2494 |
| 55 | Ga0068305_10238999 | 3300005083 | Bacteria | 5937 |
| 56 | Ga0466707_241108 | 3300042601 | Bacteria | 10272 |
| 57 | Ga0466719_132659 | 3300042606 | Bacteria | 30972 |
| 58 | Ga0466722_233453 | 3300042609 | Bacteria | 6938 |
| 59 | Ga0466723_119358 | 3300042618 | Bacteria | 14928 |
| 60 | Ga0123356_10012807 | 3300010049 | Bacteria | 8120 |
| 61 | Ga0123356_10278042 | 3300010049 | Bacteria | 1768 |
| 62 | Ga0123356_11363787 | 3300010049 | Bacteria | 871 |
| 63 | Ga0123353_10000423 | 3300010167 | Bacteria | 52369 |
| 64 | Ga0123354_10002953 | 3300010882 | Bacteria | 23087 |
| 65 | Ga0466735_079356 | 3300042624 | Bacteria | 8146 |
| 66 | Ga0466724_31268 | 3300042649 | Bacteria | 225286 |
| 67 | Ga0466727_066312 | 3300042655 | Bacteria | 11464 |
| 68 | Ga0466727_265039 | 3300042655 | Bacteria | 8851 |
| 69 | Ga0466690_037659 | 3300042590 | Bacteria | 14391 |
| 70 | Ga0466690_255390 | 3300042590 | Bacteria | 4057 |
| 71 | Ga0466692_166284 | 3300042591 | Bacteria | 10665 |
| 72 | Ga0466696_080066 | 3300042596 | Bacteria | 3660 |
| 73 | 2227563833 | 2225789004 | Bacteria | 2692 |
| 74 | Ga0068302_10145285 | 3300005071 | Unclassified | 2636 |
| 75 | Ga0072940_1315469 | 3300005200 | Bacteria | 1046 |
| 76 | Ga0466733_210739 | 3300042659 | Bacteria | 1344 |
| 77 | Ga0466700_193144 | 3300042600 | Bacteria | 1418 |
| 78 | Ga0466700_381744 | 3300042600 | Bacteria | 2459 |
| 79 | Ga0466713_059975 | 3300042602 | Bacteria | 22865 |
| 80 | Ga0466716_202084 | 3300042605 | Bacteria | 17568 |
| 81 | Ga0466719_072964 | 3300042606 | Bacteria | 3294 |
| 82 | Ga0466719_086818 | 3300042606 | Bacteria | 2700 |
| 83 | Ga0466719_331648 | 3300042606 | Bacteria | 1263 |
| 84 | Ga0466715_012770 | 3300042616 | Bacteria | 3906 |
| 85 | Ga0466715_080209 | 3300042616 | Bacteria | 5381 |
| 86 | Ga0466715_583205 | 3300042616 | Bacteria | 24186 |
| 87 | Ga0466728_335249 | 3300042620 | Bacteria | 1375 |
| 88 | Ga0123355_10001821 | 3300009826 | Bacteria | 29815 |
| 89 | Ga0466735_009555 | 3300042624 | Bacteria | 1095 |
| 90 | Ga0466704_517162 | 3300042643 | Bacteria | 1942 |
| 91 | Ga0466725_071344 | 3300042654 | Bacteria | 7932 |
| 92 | Ga0466690_048858 | 3300042590 | Bacteria | 42701 |
| 93 | Ga0123357_10001032 | 3300009784 | Bacteria | 28568 |
| 94 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 95 | Ga0466706_048730 | 3300042599 | Bacteria | 101759 |
| 96 | Ga0466707_137259 | 3300042601 | Bacteria | 1602 |
| 97 | Ga0466707_373554 | 3300042601 | Bacteria | 8608 |
| 98 | Ga0466716_072096 | 3300042605 | Bacteria | 13449 |
| 99 | Ga0466719_242706 | 3300042606 | Bacteria | 6331 |
| 100 | Ga0466715_077237 | 3300042616 | Bacteria | 28902 |
| 101 | Ga0466726_167735 | 3300042619 | Bacteria | 5364 |
| 102 | Ga0123354_10137783 | 3300010882 | Bacteria | 3040 |
| 103 | Ga0466704_194858 | 3300042643 | Bacteria | 20469 |
| 104 | Ga0466694_001019 | 3300042594 | Bacteria | 1572 |
| 105 | Ga0466696_151019 | 3300042596 | Bacteria | 3702 |
| 106 | Ga0466701_011125 | 3300042598 | Bacteria | 31883 |
| 107 | JGI24702J35022_10018786 | 3300002462 | Bacteria | 3767 |
| 108 | Ga0466733_051051 | 3300042659 | Bacteria | 11253 |
| 109 | Ga0466733_067578 | 3300042659 | Bacteria | 4628 |
| 110 | Ga0466701_058340 | 3300042598 | Bacteria | 8230 |
| 111 | Ga0466707_072578 | 3300042601 | Bacteria | 15033 |
| 112 | Ga0466713_094833 | 3300042602 | Bacteria | 47599 |
| 113 | Ga0466714_008837 | 3300042603 | Bacteria | 1080 |
| 114 | Ga0466711_045636 | 3300042615 | Bacteria | 24219 |
| 115 | Ga0466711_217459 | 3300042615 | Bacteria | 9140 |
| 116 | Ga0466715_452977 | 3300042616 | Bacteria | 2266 |
| 117 | Ga0123357_10314845 | 3300009784 | Bacteria | 1556 |
| 118 | Ga0123353_10174601 | 3300010167 | Bacteria | 3408 |
| 119 | Ga0123354_10000925 | 3300010882 | Bacteria | 32969 |
| 120 | Ga0123354_10018220 | 3300010882 | Bacteria | 11007 |
| 121 | Ga0466730_015231 | 3300042625 | Bacteria | 2385 |
| 122 | Ga0466708_290271 | 3300042652 | Bacteria | 28875 |
| 123 | Ga0466725_006692 | 3300042654 | Bacteria | 1873 |
| 124 | Ga0466690_175771 | 3300042590 | Bacteria | 56622 |
| 125 | Ga0466696_432602 | 3300042596 | Bacteria | 17624 |
| 126 | Ga0466701_005987 | 3300042598 | Bacteria | 1351 |
| 127 | IMNBL1DRAFT_c0007451 | 3300000062 | Bacteria | 5753 |
| 128 | IMNBL1DRAFT_c0047934 | 3300000062 | Bacteria | 1375 |
| 129 | Ga0068305_10002944 | 3300005083 | Bacteria | 22660 |
| 130 | Ga0466705_172980 | 3300042612 | Bacteria | 40831 |
| 131 | Ga0466732_127717 | 3300042656 | Bacteria | 1538 |
| 132 | Ga0466701_058067 | 3300042598 | Bacteria | 74144 |
| 133 | Ga0466706_135756 | 3300042599 | Bacteria | 21184 |
| 134 | Ga0466713_121173 | 3300042602 | Bacteria | 12626 |
| 135 | Ga0466705_486192 | 3300042612 | Bacteria | 7879 |
| 136 | Ga0466715_145673 | 3300042616 | Bacteria | 3539 |
| 137 | Ga0466715_188116 | 3300042616 | Bacteria | 8718 |
| 138 | Ga0466715_348253 | 3300042616 | Bacteria | 12317 |
| 139 | Ga0123354_10247080 | 3300010882 | Bacteria | 1819 |
| 140 | Ga0466735_057981 | 3300042624 | Bacteria | 1103 |
| 141 | Ga0466703_082207 | 3300042636 | Bacteria | 19739 |
| 142 | Ga0466727_008719 | 3300042655 | Bacteria | 14999 |
| 143 | Ga0466727_025347 | 3300042655 | Bacteria | 2465 |
| 144 | Ga0466727_095823 | 3300042655 | Bacteria | 11264 |
| 145 | Ga0466727_112751 | 3300042655 | Bacteria | 7654 |
| 146 | Ga0466657_291017 | 3300042582 | Bacteria | 1899 |
| 147 | Ga0466692_168442 | 3300042591 | Bacteria | 1098 |
| 148 | Ga0466694_028470 | 3300042594 | Bacteria | 1038 |
| 149 | Ga0466696_048279 | 3300042596 | Bacteria | 9304 |
| 150 | Ga0466696_158124 | 3300042596 | Bacteria | 18249 |
| 151 | Ga0466696_213692 | 3300042596 | Bacteria | 9451 |
| 152 | 2227522695 | 2225789004 | Bacteria | 3309 |
| 153 | 2227634903 | 2225789004 | Unclassified | 2097 |
| 154 | IMNBL1DRAFT_c0001623 | 3300000062 | Bacteria | 16669 |
| 155 | IMNBL1DRAFT_c0009074 | 3300000062 | Bacteria | 4977 |
| 156 | JGI24702J35022_10022440 | 3300002462 | Bacteria | 3416 |
| 157 | JGI24699J35502_11132371 | 3300002509 | Bacteria | 6759 |
| 158 | Ga0104048_1168809 | 3300007143 | Bacteria | 2793 |
| 159 | Ga0466706_010424 | 3300042599 | Bacteria | 17050 |
| 160 | Ga0466707_099950 | 3300042601 | Bacteria | 1079 |
| 161 | Ga0466713_000398 | 3300042602 | Bacteria | 12002 |
| 162 | Ga0466716_187250 | 3300042605 | Bacteria | 3361 |
| 163 | Ga0466719_298958 | 3300042606 | Bacteria | 17836 |
| 164 | Ga0466722_152891 | 3300042609 | Bacteria | 26871 |
| 165 | Ga0466722_205722 | 3300042609 | Bacteria | 13113 |
| 166 | Ga0466698_432236 | 3300042610 | Bacteria | 2396 |
| 167 | Ga0466723_199550 | 3300042618 | Bacteria | 8988 |
| 168 | Ga0466726_097828 | 3300042619 | Bacteria | 1224 |
| 169 | Ga0466726_300403 | 3300042619 | Bacteria | 11532 |
| 170 | Ga0466726_486113 | 3300042619 | Bacteria | 1068 |
| 171 | Ga0466728_109015 | 3300042620 | Bacteria | 4195 |
| 172 | Ga0123357_10324166 | 3300009784 | Bacteria | 1516 |
| 173 | Ga0123353_11403178 | 3300010167 | Bacteria | 898 |
| 174 | Ga0466735_096576 | 3300042624 | Bacteria | 1445 |
| 175 | Ga0466703_331732 | 3300042636 | Bacteria | 9966 |
| 176 | Ga0466727_182646 | 3300042655 | Bacteria | 2013 |
| 177 | Ga0466727_335323 | 3300042655 | Bacteria | 2434 |
| 178 | Ga0466696_384414 | 3300042596 | Bacteria | 1076 |
| 179 | 2227632943 | 2225789004 | Bacteria | 11346 |
| 180 | JGI24699J35502_11133974 | 3300002509 | Bacteria | 22272 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00849 | PseudoU_synth_2 | RNA pseudouridylate synthase | 33 | 188 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.