Protein Family IF05832
Metagenome
Isolate
125
Members
68
Samples
99
Scaffolds
560.84
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_118981|Ga0466707_118981_2351_4192
- Length
- 613 aa
- Sequence
- MGFLFPFDVTGKQKDIALKTVNPANHPTDYGSRLLPICPYLLIFVVEIPYVMRCYSILSCFAGVMLAICPASLQGQELRNPFDFPIVLSGSFGELRANHFHSGLDFKTQGVEGKAVHAVEAGYVSRISVSPGGYGNVLYITHPSGITTVYAHLQRFAPEIAAYVKEQQYAAESFRVNLLPGPEQFPTGKGDVVAWSGNTGSSGGPHLHFEVRDTESEEVLDPLVYYRERISDTRPPRIDGIMIYPAEGKGVVNGSGRKQEFKRSAARDGGALALNGRIEAWGKIGIAVKAYDYMDGTQNIYGVKEITLKADSQVIFHSCIDRFAFDESRYLNSFIDYAEWTDNRSFYMKSFVEPGNRLRFFDTRNRGYLTIDREQTYHLQYVLADVYGHTARLSFTIEGKEQVVPLPETGAERFYRNVENHFGAKGVRLTIPYGNLYDDLYFRYAVKEDSTALAGTHLLHDRPLAFHQAARLSLRLSKDTLANKEQYGIVRIHRGRYLWTGGTYRDGWIEAPIGELGKYTVAADTVAPVITPVDQPAWKGNKRFVFRLSDNLSGVAGYRGEIDGQYALFEMDNHSVITYRFDGERLAQGAHTLRLTAADACGNETIYTYKFNY
Sample Types
Isolate
20.8%
Metagenome
79.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.3%
Kalotermitidae
21.2%
Termitidae
15.2%
Unclassified
7.6%
Passalidae
4.5%
Armadillidiidae
4.5%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Hodotermitidae
1.5%
Formicidae
1.5%
Nephropidae
1.5%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 2 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 3 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 4 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 5 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 6 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 13 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 14 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 15 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 16 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 25 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 26 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 27 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 28 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 29 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 32 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 33 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 37 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 38 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 39 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 40 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 52 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 53 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 54 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 55 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 56 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 64 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 65 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 66 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 67 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 68 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_280525 | 3300042612 | Bacteria | 10801 |
| 2 | Ga0466732_041734 | 3300042656 | Bacteria | 75299 |
| 3 | Ga0466715_065641 | 3300042616 | Bacteria | 5596 |
| 4 | Ga0160464_100140 | 3300012805 | Bacteria | 79019 |
| 5 | Ga0466692_141398 | 3300042591 | Bacteria | 5091 |
| 6 | Ga0466696_220112 | 3300042596 | Bacteria | 7899 |
| 7 | Ga0466707_118981 | 3300042601 | Bacteria | 4301 |
| 8 | Ga0466707_188845 | 3300042601 | Bacteria | 16270 |
| 9 | Ga0466716_230301 | 3300042605 | Bacteria | 8125 |
| 10 | IMNBL1DRAFT_c0000079 | 3300000062 | Bacteria | 87281 |
| 11 | IMNBL1DRAFT_c0003813 | 3300000062 | Bacteria | 9395 |
| 12 | Ga0068305_10064743 | 3300005083 | Bacteria | 15354 |
| 13 | Ga0466703_166586 | 3300042636 | Bacteria | 1959 |
| 14 | Ga0466703_320165 | 3300042636 | Bacteria | 13646 |
| 15 | Ga0466704_180446 | 3300042643 | Bacteria | 10940 |
| 16 | Ga0466709_062906 | 3300042648 | Bacteria | 1810 |
| 17 | Ga0466705_053984 | 3300042612 | Bacteria | 7693 |
| 18 | Ga0466705_169781 | 3300042612 | Bacteria | 18950 |
| 19 | Ga0466705_438866 | 3300042612 | Bacteria | 4156 |
| 20 | Ga0123353_10215985 | 3300010167 | Bacteria | 3004 |
| 21 | Ga0123353_10454296 | 3300010167 | Bacteria | 1885 |
| 22 | Ga0160433_100351 | 3300012846 | Bacteria | 27213 |
| 23 | Ga0466713_077022 | 3300042602 | Bacteria | 15402 |
| 24 | Ga0466716_399890 | 3300042605 | Bacteria | 9947 |
| 25 | Ga0466722_153819 | 3300042609 | Bacteria | 6968 |
| 26 | Ga0466722_233912 | 3300042609 | Bacteria | 9388 |
| 27 | JGI24696J40584_12956741 | 3300002834 | Bacteria | 3214 |
| 28 | Ga0466704_028371 | 3300042643 | Bacteria | 10898 |
| 29 | Ga0466733_056566 | 3300042659 | Bacteria | 66737 |
| 30 | Ga0466711_340350 | 3300042615 | Bacteria | 11504 |
| 31 | Ga0466711_424379 | 3300042615 | Bacteria | 3153 |
| 32 | Ga0466715_188075 | 3300042616 | Bacteria | 87062 |
| 33 | Ga0160445_100508 | 3300012847 | Unclassified | 19055 |
| 34 | Ga0466692_038856 | 3300042591 | Bacteria | 66664 |
| 35 | Ga0466696_471991 | 3300042596 | Bacteria | 8662 |
| 36 | Ga0466701_073839 | 3300042598 | Bacteria | 6852 |
| 37 | Ga0466707_081394 | 3300042601 | Bacteria | 8758 |
| 38 | Ga0466719_222632 | 3300042606 | Bacteria | 13943 |
| 39 | Ga0466709_179213 | 3300042648 | Bacteria | 3721 |
| 40 | Ga0466725_157962 | 3300042654 | Bacteria | 30767 |
| 41 | Ga0466705_175096 | 3300042612 | Bacteria | 32654 |
| 42 | Ga0466733_108250 | 3300042659 | Bacteria | 6704 |
| 43 | Ga0466733_130252 | 3300042659 | Bacteria | 8712 |
| 44 | Ga0466711_239934 | 3300042615 | Bacteria | 17196 |
| 45 | Ga0466711_282013 | 3300042615 | Bacteria | 7855 |
| 46 | Ga0466696_244013 | 3300042596 | Bacteria | 5479 |
| 47 | Ga0466722_203003 | 3300042609 | Bacteria | 20008 |
| 48 | JGI24705J35276_12236789 | 3300002504 | Bacteria | 8929 |
| 49 | Ga0466711_101292 | 3300042615 | Bacteria | 10482 |
| 50 | Ga0466715_079967 | 3300042616 | Bacteria | 5033 |
| 51 | Ga0160433_100421 | 3300012846 | Bacteria | 22611 |
| 52 | Ga0466690_149910 | 3300042590 | Bacteria | 3707 |
| 53 | Ga0466692_127213 | 3300042591 | Bacteria | 4561 |
| 54 | Ga0466707_048942 | 3300042601 | Bacteria | 15157 |
| 55 | Ga0466722_058028 | 3300042609 | Bacteria | 4931 |
| 56 | JGI24702J35022_10000259 | 3300002462 | Bacteria | 30226 |
| 57 | JGI24702J35022_10007161 | 3300002462 | Bacteria | 6413 |
| 58 | Ga0466709_209153 | 3300042648 | Bacteria | 4039 |
| 59 | Ga0466708_228442 | 3300042652 | Bacteria | 4630 |
| 60 | Ga0466727_197964 | 3300042655 | Bacteria | 22347 |
| 61 | Ga0466727_313475 | 3300042655 | Bacteria | 4641 |
| 62 | Ga0466711_010134 | 3300042615 | Bacteria | 3372 |
| 63 | Ga0466711_066519 | 3300042615 | Bacteria | 37581 |
| 64 | Ga0466711_214846 | 3300042615 | Bacteria | 20080 |
| 65 | Ga0466711_223836 | 3300042615 | Bacteria | 37949 |
| 66 | Ga0466726_415280 | 3300042619 | Bacteria | 4217 |
| 67 | Ga0123353_10025466 | 3300010167 | Bacteria | 9016 |
| 68 | Ga0466656_036778 | 3300042550 | Bacteria | 3725 |
| 69 | Ga0466696_295020 | 3300042596 | Bacteria | 31908 |
| 70 | Ga0466700_249204 | 3300042600 | Bacteria | 41013 |
| 71 | Ga0466713_017744 | 3300042602 | Bacteria | 33043 |
| 72 | Ga0466722_219492 | 3300042609 | Bacteria | 63959 |
| 73 | Ga0466703_099783 | 3300042636 | Bacteria | 2357 |
| 74 | Ga0466708_028736 | 3300042652 | Bacteria | 16446 |
| 75 | Ga0466715_045974 | 3300042616 | Bacteria | 42084 |
| 76 | Ga0466723_092210 | 3300042618 | Bacteria | 16133 |
| 77 | Ga0466728_339660 | 3300042620 | Bacteria | 14592 |
| 78 | Ga0466729_192842 | 3300042621 | Bacteria | 7074 |
| 79 | Ga0160444_100218 | 3300012841 | Bacteria | 49781 |
| 80 | Ga0466706_023408 | 3300042599 | Bacteria | 7020 |
| 81 | 2227008135 | 2225789003 | Bacteria | 27247 |
| 82 | Ga0068302_10158821 | 3300005071 | Unclassified | 1936 |
| 83 | Ga0103265_1000609 | 3300007068 | Bacteria | 6025 |
| 84 | Ga0466703_092372 | 3300042636 | Bacteria | 7662 |
| 85 | Ga0466704_069957 | 3300042643 | Bacteria | 18760 |
| 86 | Ga0466704_124229 | 3300042643 | Bacteria | 13880 |
| 87 | Ga0466708_101648 | 3300042652 | Bacteria | 32818 |
| 88 | Ga0466708_310919 | 3300042652 | Bacteria | 7713 |
| 89 | Ga0466708_332352 | 3300042652 | Bacteria | 2450 |
| 90 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 91 | Ga0466690_180551 | 3300042590 | Bacteria | 65151 |
| 92 | Ga0466691_193013 | 3300042593 | Bacteria | 11280 |
| 93 | Ga0466707_058866 | 3300042601 | Bacteria | 13756 |
| 94 | Ga0466722_065825 | 3300042609 | Bacteria | 12557 |
| 95 | 2227505164 | 2225789004 | Bacteria | 19074 |
| 96 | IMNBL1DRAFT_c0000298 | 3300000062 | Bacteria | 42272 |
| 97 | IMNBL1DRAFT_c0006606 | 3300000062 | Bacteria | 6293 |
| 98 | Ga0466703_186467 | 3300042636 | Bacteria | 3521 |
| 99 | Ga0466704_170415 | 3300042643 | Bacteria | 25587 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01551 | Peptidase_M23 | Peptidase family M23 | 100 | 170 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.