Protein Family IF05830

Metagenome Isolate
165 Members
120 Samples
85 Scaffolds
374.63 Avg Length

🧬 Representative Sequence

ID
3300042601|Ga0466707_113367|Ga0466707_113367_161_1363
Length
400 aa
Sequence
MKIQRAQTAAADGGKGGTYDGEMAQVSESDVRAALARVQDPEIRKPITEIGMVGDIVIGDDNSVKVGIYLTTSGCPLRTEIEKRVKAAVADVPGAGAVTVELDVMNDEQKAMLRKTLHGDSNAPIIPFAQPGNRTRVYAVASGKGGVGKSSVTVNIAASLAARGLSVGLLDADIYGHSVPRMLGTTARPTQVDKMIVPPIAHEVRVVSIAQFTQGNVPVVWRGPMLHRVLQQFLADVFWGDLDVLLLDLPPGTGDIAISVAQLIPNAEILVVTTPQLAAAEVAERAGAIALQTRQRLVGVVENMSWMTMPDGSRMDVFGAGGGQVVANRLTRALGADVPLLGQIPLDQRLREGGDDGVPVVLGAPDTEAAKALESIADKLAVRKRGLAGMSLGIDTTRHP

📊 Sample Types

Isolate 48.5%
Metagenome 51.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 28.9%
Termitidae 18.4%
Formicidae 16.7%
Tenebrionidae 6.1%
Kalotermitidae 5.3%
Culicidae 4.4%
Elmidae 3.5%
Cambaridae 2.6%
Scarabaeidae 1.8%
Termopsidae 1.8%
Hydrophilidae 1.8%
Ixodidae 0.9%
Curculionidae 0.9%
Hodotermitidae 0.9%
Cimicidae 0.9%
Apidae 0.9%
Pyralidae 0.9%
Armadillidiidae 0.9%
Siricidae 0.9%
Reduviidae 0.9%
Cerambycidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
2 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
3 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
4 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
5 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
6 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
7 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
8 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
9 2896955351 Streptomyces sp. GF20 Isolate Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
13 649989992 Pseudonocardia sp. P1 Isolate Formicidae
14 8073544309 Actinomadura sp. RB99 Isolate Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
18 2504756063 Isoptericola variabilis J5 Isolate Unclassified
19 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
20 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
21 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
22 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
23 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
24 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
25 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
26 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
27 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
28 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
29 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
30 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
31 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
32 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
33 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
34 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
35 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
36 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
37 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
38 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
39 2505679068 Isoptericola variabilis 225 Isolate Unclassified
40 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
41 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
42 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
43 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
44 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
45 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
46 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
47 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
48 8062637095 Yimella sp. cx-51 Isolate Cambaridae
49 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
50 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
51 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
52 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
53 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
54 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
55 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
56 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
57 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
58 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
59 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
60 2820876581 Unclassified Actinobacteria Lab288P1bin83 Isolate Unclassified
61 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
62 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
63 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
64 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
65 2862784999 Streptomyces sp. M41 Isolate Unclassified
66 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
67 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
68 2909412500 Yimella sp. cx-573 Isolate Cambaridae
69 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
70 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
71 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
72 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
73 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
74 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
75 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
76 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
77 2900368070 Nocardia aurantia RB56 Isolate Termitidae
78 2912749649 Streptomyces sp. GS7 Isolate Termitidae
79 8062747827 Yimella sp. cx-51 Isolate Cambaridae
80 3006461590 Streptomyces sp. RB5 Isolate Termitidae
81 3006667155 Streptomyces sp. SID9727 Isolate
82 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
83 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
84 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
85 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
86 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
87 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
88 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
89 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
90 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
91 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
92 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
93 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
94 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
95 2908241010 Streptomyces sp. HF10 Isolate Termitidae
96 2912817845 Streptomyces griseus SID164 Isolate
97 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
98 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
99 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
100 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
101 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
102 3006468911 Streptomyces sp. RB17 Isolate Termitidae
103 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
104 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
105 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
106 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
107 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
108 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
109 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
110 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
111 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
112 2547132081 Streptomyces sp. S4 Isolate Formicidae
113 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
114 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
115 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
116 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
117 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
118 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
119 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
120 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_034336 3300042612 Bacteria 2397
2 Ga0466733_087904 3300042659 Bacteria 11755
3 Ga0562374_0746 3300057007 Bacteria 47794
4 Ga0562374_2327 3300057007 Unclassified 17109
5 Ga0160457_1000295 3300012858 Bacteria 31057
6 Ga0466734_092640 3300042623 Bacteria 2107
7 Ga0123353_10003248 3300010167 Unclassified 20497
8 Ga0562379_0149 3300056790 Bacteria 210994
9 Ga0562377_0190 3300056842 Bacteria 160537
10 Ga0562377_1694 3300056842 Bacteria 20853
11 Ga0562376_0050 3300056857 Bacteria 302526
12 Ga0562376_0134 3300056857 Bacteria 164011
13 Ga0562374_0329 3300057007 Unclassified 88952
14 Ga0068302_10107190 3300005071 Bacteria 3687
15 Ga0072941_1140745 3300005201 Bacteria 17075
16 Ga0160448_110227 3300012854 Unclassified 1993
17 Ga0466696_439691 3300042596 Bacteria 2654
18 Ga0466707_113367 3300042601 Bacteria 1505
19 Ga0466707_130928 3300042601 Bacteria 85348
20 Ga0466730_004378 3300042625 Bacteria 8913
21 Ga0466730_023856 3300042625 Bacteria 6761
22 Ga0466733_037488 3300042659 Bacteria 18659
23 Ga0530661_002528 3300056564 Unclassified 6763
24 Ga0562377_0107 3300056842 Bacteria 267817
25 Ga0562377_0154 3300056842 Bacteria 196497
26 Ga0562375_0574 3300056856 Bacteria 72250
27 Ga0160432_101617 3300012818 Bacteria 6638
28 Ga0466693_175073 3300042592 Bacteria 99322
29 Ga0562379_0416 3300056790 Unclassified 92586
30 Ga0562375_0370 3300056856 Bacteria 100886
31 Ga0160436_1001904 3300012861 Bacteria 5514
32 Ga0466706_017132 3300042599 Bacteria 1527
33 Ga0466713_087505 3300042602 Bacteria 4153
34 Ga0466713_110872 3300042602 Bacteria 77171
35 Ga0123357_10112249 3300009784 Bacteria 3470
36 Ga0123355_10261749 3300009826 Bacteria 2418
37 Ga0123356_10000015 3300010049 Bacteria 187518
38 Ga0123354_10081620 3300010882 Bacteria 4566
39 Ga0562378_0006 3300056814 Bacteria 1902205
40 Ga0562375_3409 3300056856 Unclassified 14991
41 Ga0466715_566181 3300042616 Bacteria 5194
42 JGI24699J35502_11112179 3300002509 Bacteria 2750
43 Ga0160452_100013 3300012834 Bacteria 343612
44 Ga0160472_100006 3300012839 Bacteria 656551
45 Ga0160448_101353 3300012854 Bacteria 7917
46 Ga0466727_214475 3300042655 Bacteria 1110
47 Ga0123355_10005052 3300009826 Unclassified 19215
48 Ga0160442_100203 3300012806 Unclassified 48435
49 Ga0562378_0238 3300056814 Bacteria 128710
50 Ga0562377_1161 3300056842 Bacteria 30598
51 Ga0562375_0002 3300056856 Bacteria 3523859
52 Ga0562376_0840 3300056857 Bacteria 49037
53 Ga0562374_3570 3300057007 Bacteria 7941
54 Ga0123357_10000014 3300009784 Bacteria 149146
55 Ga0160446_100007 3300012835 Bacteria 393914
56 Ga0160436_1000941 3300012861 Unclassified 8860
57 Ga0123353_10004642 3300010167 Unclassified 17742
58 Ga0530661_000021 3300056564 Bacteria 209934
59 Ga0562379_0008 3300056790 Bacteria 1928858
60 Ga0562375_0051 3300056856 Bacteria 467539
61 Ga0562375_0295 3300056856 Bacteria 125606
62 Ga0562376_1630 3300056857 Unclassified 30424
63 Ga0466728_308776 3300042620 Bacteria 2351
64 Ga0466706_080441 3300042599 Bacteria 247551
65 Ga0466706_274816 3300042599 Bacteria 2292
66 Ga0466713_000844 3300042602 Bacteria 3302
67 Ga0466713_105765 3300042602 Bacteria 92337
68 Ga0466730_018932 3300042625 Bacteria 159047
69 Ga0466703_202353 3300042636 Bacteria 12100
70 Ga0466704_170151 3300042643 Bacteria 6519
71 Ga0123353_10169353 3300010167 Unclassified 3468
72 Ga0123354_10361720 3300010882 Bacteria 1278
73 Ga0466705_151903 3300042612 Bacteria 8477
74 Ga0562379_0438 3300056790 Unclassified 88173
75 Ga0562378_0226 3300056814 Bacteria 131582
76 Ga0562374_0264 3300057007 Bacteria 104081
77 Ga0466718_161486 3300042617 Bacteria 1398
78 Ga0160458_110851 3300012832 Unclassified 1013
79 Ga0160452_100590 3300012834 Bacteria 20304
80 Ga0466693_227909 3300042592 Bacteria 21993
81 Ga0466704_527075 3300042643 Bacteria 9478
82 Ga0466724_69064 3300042649 Bacteria 4138
83 Ga0123356_10065519 3300010049 Bacteria 3399
84 Ga0123356_10349912 3300010049 Bacteria 1601
85 Ga0123354_10002803 3300010882 Unclassified 23480

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF10609 ParA NUBPL iron-transfer P-loop NTPase 135 380 0.95
PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein 29 101 0.94
PF13614 AAA_31 AAA domain 136 179 0.83
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 139 358 0.77
PF09140 MipZ ATPase MipZ 139 207 0.65

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.